Signal Peptide Database - Bacteria

 Entry Details
ID   108
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q7MFM6    (Created: 2004-03-15 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CATA_VIBVY
Protein Name   Catalase
Gene   VVA0294
Organism Scientific   Vibrio vulnificus (strain YJ016)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Vibrionales
        Vibrionaceae
          Vibrio
Protein Length [aa]   508
Protein Mass [Da]   56608
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Catalase      22   508
active site      by similarity   72   72
active site      by similarity   145   145
metal ion-binding site   Iron (heme axial ligand)   by similarity   353   353
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MHMSKSFLLISMGLASISVHA
Sequence MHMSKSFLLISMGLASISVHAQTLTRDNGAPVGDNQNSITAGENGSVLLQ
DVHLIQKLQRFARERIPERVV
HARGTGAHGEFVASGDFSDLTLSSPFAQS
GKVTPVFVRFSTVIHSKGSPETLRDPRGFATKFYTDQGNWDLVG
NNLPVF
FIRDSIKFPDMVHSLKPSPVTNLQDPNRFFDFFSSQPSATNMLTWVYTNL
GTPASYRTMDGFGVHAYKWINQKGEVNYVKFHWKSQQGVKSLRPAEVTKV
QGEDFNHLTNDLYTQINAGNFPKWDLYVKVLSPKALSKLDYNGLDATKVW
LDVPEKKVGTMTLNRVPDNFFLETEQSAFAPSNIIPGIEPSEDRLLQGRL
FA
YADTQLYRLGANLFQLPVNSPKSPVANHNQDGPSNNSTGLGNVDSLDV
NYEPSRLVNLTVDKQARAVETPLSGHVQQQAIRNPRDFFQAGVLYRSLSE
QDKADLIHNLSGDLNKVNDAEVKAIMVSYFYRADKEYGTRLAKATDVNLK
QVTKLASM
Original MHMSKSFLLISMGLASISVHAQTLTRDNGAPVGDNQNSITAGENGSVLLQ
DVHLIQKLQRFARERIPERVVHARGTGAHGEFVASGDFSDLTLSSPFAQS
GKVTPVFVRFSTVIHSKGSPETLRDPRGFATKFYTDQGNWDLVGNNLPVF
FIRDSIKFPDMVHSLKPSPVTNLQDPNRFFDFFSSQPSATNMLTWVYTNL
GTPASYRTMDGFGVHAYKWINQKGEVNYVKFHWKSQQGVKSLRPAEVTKV
QGEDFNHLTNDLYTQINAGNFPKWDLYVKVLSPKALSKLDYNGLDATKVW
LDVPEKKVGTMTLNRVPDNFFLETEQSAFAPSNIIPGIEPSEDRLLQGRL
FAYADTQLYRLGANLFQLPVNSPKSPVANHNQDGPSNNSTGLGNVDSLDV
NYEPSRLVNLTVDKQARAVETPLSGHVQQQAIRNPRDFFQAGVLYRSLSE
QDKADLIHNLSGDLNKVNDAEVKAIMVSYFYRADKEYGTRLAKATDVNLK
QVTKLASM
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11