Signal Peptide Database - Bacteria

 Entry Details
ID   125
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P52226    (Created: 1996-10-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   CCMH_PSEFL
Protein Name   Cytochrome c-type biogenesis protein ccmH
Gene   ccmH
Organism Scientific   Pseudomonas fluorescens
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Pseudomonadales
        Pseudomonadaceae
          Pseudomonas
Protein Length [aa]   156
Protein Mass [Da]   17470
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Cytochrome c-type biogenesis protein ccmH      20   156
transmembrane region      potential   104   124
binding site   Heme (covalent)   potential   44   44
binding site   Heme (covalent)   potential   47   47
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKRLLAAAVCLGPGRCGHA
Sequence MKRLLAAAVCLGPGRCGHAAIDTYEFANDAERERFRDLTKELRCPKCQNQ
DIADSNAPIATDLRREIFRMLGEGKDDQQIIDFMVDRYGDFVRYKPALTG
KTA
LLWFGPAGLLLAGVVVMAVIVRRRRAAPTDGSDALSPEERKRLDQLL
DTKTDD
Original MKRLLAAAVCLGPGRCGHAAIDTYEFANDAERERFRDLTKELRCPKCQNQ
DIADSNAPIATDLRREIFRMLGEGKDDQQIIDFMVDRYGDFVRYKPALTG
KTALLWFGPAGLLLAGVVVMAVIVRRRRAAPTDGSDALSPEERKRLDQLL
DTKTDD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11