Signal Peptide Database - Bacteria

 Entry Details
ID   132
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P31746    (Created: 1993-07-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CDGT_BACS2
Protein Name   Cyclomaltodextrin glucanotransferase
Gene   cgt
Organism Scientific   Bacillus sp. (strain 1-1)
Organism Common  
Lineage   Bacteria
  Firmicutes
    Bacillales
      Bacillaceae
        Bacillus
Protein Length [aa]   703
Protein Mass [Da]   78663
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   29
chain   Cyclomaltodextrin glucanotransferase      30   703
disulfide bond      by similarity   68   75
domain   IPT/TIG      520   598
domain   CBM20      599   703
region of interest   A1      30   160
region of interest   B      161   224
region of interest   A2      225   428
region of interest   C      429   516
region of interest   D      517   600
region of interest   E      601   703
active site   Nucleophile   by similarity   251   251
active site   Proton donor   by similarity   279   279
active site      by similarity   350   350
metal ion-binding site   Calcium 2   by similarity   52   52
metal ion-binding site   Calcium 2; via carbonyl oxygen   by similarity   54   54
metal ion-binding site   Calcium 2   by similarity   57   57
metal ion-binding site   Calcium 2   by similarity   58   58
metal ion-binding site   Calcium 2; via carbonyl oxygen   by similarity   76   76
metal ion-binding site   Calcium 2   by similarity   78   78
metal ion-binding site   Calcium 1   by similarity   161   161
metal ion-binding site   Calcium 1; via carbonyl oxygen   by similarity   212   212
metal ion-binding site   Calcium 1   by similarity   221   221
metal ion-binding site   Calcium 1; via carbonyl oxygen   by similarity   255   255
SP Length   29
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNDLNDFLKTILLSFIFFLLLSLPTVAEA
Sequence MNDLNDFLKTILLSFIFFLLLSLPTVAEADVTNKVNYSKDVIYQIVTDRF
S
DGNPGNNPSGAIFSQNCIDLHKYCGGDWQGIIDKINDGYLTDLGITALW
ISQPVENVYALHPSGYTSYHGYWARDYKKTNPYYGNFDDFDRLMSTAHSN
GIKVIMDFTP
NHSSPALETNPNYVENGAIYDNGALLGNYSNDQQNLFHHN
GGTDFSSYEDS
IYRNLYDLADYDLNNTVMDQYLKESIKFWLDKGIDGIRV
DAVKHMSEGWQTSLMSEIYSHKPVFTFGEWFLGSGEVDPQNHHFANESGM
SLLDFQFGQTIRNVLKDRTSNWYDFNEMITSTEKEYNEVIDQVTFIDNH
D
MSRFSVGSSSNRQTDMALAVLLTSRGVPTIYYGTEQYVTGGNDPENRKPL
KTFDRSTNSYQIISKLASLRQTNSALGY
GTTTERWLNEDIYIYERTFGNS
IVLTAVNSSNSNQTITNLNTSLPQGNYTDELQQRLDGNTITVNANGAVNS
FQLRANSVAVWQVSNP
STSPLIGQVGPMMGKAGNTITVSGEGFGDERGSV
LFDSTSSEIISWSNTKISVKVPNVAGGYYDLSVVTAANIKSPTYKEFEVL
SGNQVSVRFGVNNATTSPGTNLYIVGNVNELGNWDADKAIGPMFNQVMYQ
YPTWYYDISVPAGKNLEYKYIKKDQNGNVVWQSGNNRTYTSPTTGTDTVM
INW
Original MNDLNDFLKTILLSFIFFLLLSLPTVAEADVTNKVNYSKDVIYQIVTDRF
SDGNPGNNPSGAIFSQNCIDLHKYCGGDWQGIIDKINDGYLTDLGITALW
ISQPVENVYALHPSGYTSYHGYWARDYKKTNPYYGNFDDFDRLMSTAHSN
GIKVIMDFTPNHSSPALETNPNYVENGAIYDNGALLGNYSNDQQNLFHHN
GGTDFSSYEDSIYRNLYDLADYDLNNTVMDQYLKESIKFWLDKGIDGIRV
DAVKHMSEGWQTSLMSEIYSHKPVFTFGEWFLGSGEVDPQNHHFANESGM
SLLDFQFGQTIRNVLKDRTSNWYDFNEMITSTEKEYNEVIDQVTFIDNHD
MSRFSVGSSSNRQTDMALAVLLTSRGVPTIYYGTEQYVTGGNDPENRKPL
KTFDRSTNSYQIISKLASLRQTNSALGYGTTTERWLNEDIYIYERTFGNS
IVLTAVNSSNSNQTITNLNTSLPQGNYTDELQQRLDGNTITVNANGAVNS
FQLRANSVAVWQVSNPSTSPLIGQVGPMMGKAGNTITVSGEGFGDERGSV
LFDSTSSEIISWSNTKISVKVPNVAGGYYDLSVVTAANIKSPTYKEFEVL
SGNQVSVRFGVNNATTSPGTNLYIVGNVNELGNWDADKAIGPMFNQVMYQ
YPTWYYDISVPAGKNLEYKYIKKDQNGNVVWQSGNNRTYTSPTTGTDTVM
INW
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11