Signal Peptide Database - Bacteria

 Entry Details
ID   147
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P11220    (Created: 1989-07-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CHIT_STRPL
Protein Name   Chitinase 63
Gene   chtA
Organism Scientific   Streptomyces plicatus
Organism Common  
Lineage   Bacteria
  Actinobacteria
    Actinobacteridae
      Actinomycetales
        Streptomycineae
          Streptomycetaceae
            Streptomyces
Protein Length [aa]   610
Protein Mass [Da]   63974
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   30
chain   Chitinase 63      31   610
domain   CBM2      31   134
domain   Fibronectin type-III      142   224
region of interest   Catalytic      236   610
active site   Proton donor   by similarity   383   383
SP Length   30
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRFRHKAAALAATLALPLAGLVGLASPAQA
Sequence MRFRHKAAALAATLALPLAGLVGLASPAQAATSATATFQKTSDWGTGFGG
KWTVKNTGTTSLSSWTVEWDFPSGTKVTSAWDATVTNSADHWTAKNVGWN
GTLAPGASVSFGFNGSGPGSPSGCKINGGSCDGS
SVPGDEAPSAPGTPTA
SNITDTSVKLSWSAATDDKGVKNYDVLRDGATVATVTGTTYTDNGLTKGT
DYSYSVKARDTGDQTGPASGSVKV
TTTGGDGGEPNPNPGAEVKMGYFTNW
GVYGRNYHVKNLVTSGSAEKITHINLRFGNVQGGKCTIGDAYADYDKAYT
ADQSVDGVADTWDQPLRANFNQLRNLKAEYPHIKILYSFGGWTWSGGFPD
AVKNPAAFAKSCHDLVEDPRWADVFDGIDLDW
EYPNACGLSCDETSAPNA
FSSMMKAMRAEFGQDYLITAAVTADGSDGGKIDAADYGEASKYIDWYNVM
TYDFFGAWAKNGPTAPHSPLNAYDGIPQQGFTTADAMAKFKSKGVPADKL
LIGIGFYGRGWTGVTQSAPGGTATGPAAGTYEAGIEDYKVLKNSCPATGT
VAGTAYAHCGTNWWSYDTPATIKSKMDWAEQQGLGGAFFWEFSGDTTNGE
LVSAIDSGLK
Original MRFRHKAAALAATLALPLAGLVGLASPAQAATSATATFQKTSDWGTGFGG
KWTVKNTGTTSLSSWTVEWDFPSGTKVTSAWDATVTNSADHWTAKNVGWN
GTLAPGASVSFGFNGSGPGSPSGCKINGGSCDGSSVPGDEAPSAPGTPTA
SNITDTSVKLSWSAATDDKGVKNYDVLRDGATVATVTGTTYTDNGLTKGT
DYSYSVKARDTGDQTGPASGSVKVTTTGGDGGEPNPNPGAEVKMGYFTNW
GVYGRNYHVKNLVTSGSAEKITHINLRFGNVQGGKCTIGDAYADYDKAYT
ADQSVDGVADTWDQPLRANFNQLRNLKAEYPHIKILYSFGGWTWSGGFPD
AVKNPAAFAKSCHDLVEDPRWADVFDGIDLDWEYPNACGLSCDETSAPNA
FSSMMKAMRAEFGQDYLITAAVTADGSDGGKIDAADYGEASKYIDWYNVM
TYDFFGAWAKNGPTAPHSPLNAYDGIPQQGFTTADAMAKFKSKGVPADKL
LIGIGFYGRGWTGVTQSAPGGTATGPAAGTYEAGIEDYKVLKNSCPATGT
VAGTAYAHCGTNWWSYDTPATIKSKMDWAEQQGLGGAFFWEFSGDTTNGE
LVSAIDSGLK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11