Signal Peptide Database - Bacteria

 Entry Details
ID   183
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P0AEA3    (Created: 2005-12-06 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   CSGG_ECOL6
Protein Name   Curli production assembly/transport component csgG
Gene   csgG
Organism Scientific   Escherichia coli O6
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Escherichia
Protein Length [aa]   277
Protein Mass [Da]   30557
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   15
chain   Curli production assembly/transport component csgG      16   277
lipid moiety-binding region   N-palmitoyl cysteine   potential   16   16
lipid moiety-binding region   S-diacylglycerol cysteine   potential   16   16
SP Length   15
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MQRLFLLVAVMLLSG
Sequence MQRLFLLVAVMLLSGCLTAPPKEAARPTLMPRAQSYKDLTHLPAPTGKIF
VSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQG
LQNLLNERKIIRAAQENGTVAINNRIPLQSLTAANIMVEGSIIGYESNVK
SGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYE
VQAGVFRFIDYQRLLEGEVGYTSNEPVMLCLMSAIETGVIFLINDGIDRG
LWDLQNKAERQNDILVKYRHMSVPPES
Original MQRLFLLVAVMLLSGCLTAPPKEAARPTLMPRAQSYKDLTHLPAPTGKIF
VSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQG
LQNLLNERKIIRAAQENGTVAINNRIPLQSLTAANIMVEGSIIGYESNVK
SGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYE
VQAGVFRFIDYQRLLEGEVGYTSNEPVMLCLMSAIETGVIFLINDGIDRG
LWDLQNKAERQNDILVKYRHMSVPPES
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11