Signal Peptide Database - Bacteria

 Entry Details
ID   212
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q0I873    (Created: 2008-07-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CYF_SYNS3
Protein Name   Apocytochrome f
Gene   petA
Organism Scientific   Synechococcus sp. (strain CC9311)
Organism Common  
Lineage   Bacteria
  Cyanobacteria
    Chroococcales
      Synechococcus
Protein Length [aa]   310
Protein Mass [Da]   32715
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   23
chain   Apocytochrome f      24   310
transmembrane region      potential   277   297
metal ion-binding site   Iron (heme axial ligand); via amino nitrogen   by similarity   28   28
metal ion-binding site   Iron (heme axial ligand)   by similarity   52   52
binding site   Heme (covalent)   by similarity   48   48
binding site   Heme (covalent)   by similarity   51   51
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRRLLSSTFAALIVGLAVFSAPA
Sequence MRRLLSSTFAALIVGLAVFSAPAASWAYPFWAQQNYDSPREATGKIVCAN
CHLAQKLTQAEVPQSVLPDSVFKAVVKIPYDTGVQELGADGSQVPLQVGA
VVMLPDGFTLAPQDRWTDEIKEETEGVYFTEYSDDQPNVILVGPIPGDEH
QEIVFPVLAPDPATDSSISFGKYSIHVGGNRGRGQVYPTGEKSNNTVYTA
PASGSVSAIEPGDNGASVVTVKSADGAEITETVPVGPALLVSVGDVVEAG
APITDDPNVGGFGQLDTEVVLQNPVR
IYGMLAFFAAVALAQIMLVLKKRQ
IEKVQAAEGV
Original MRRLLSSTFAALIVGLAVFSAPAASWAYPFWAQQNYDSPREATGKIVCAN
CHLAQKLTQAEVPQSVLPDSVFKAVVKIPYDTGVQELGADGSQVPLQVGA
VVMLPDGFTLAPQDRWTDEIKEETEGVYFTEYSDDQPNVILVGPIPGDEH
QEIVFPVLAPDPATDSSISFGKYSIHVGGNRGRGQVYPTGEKSNNTVYTA
PASGSVSAIEPGDNGASVVTVKSADGAEITETVPVGPALLVSVGDVVEAG
APITDDPNVGGFGQLDTEVVLQNPVRIYGMLAFFAAVALAQIMLVLKKRQ
IEKVQAAEGV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11