Signal Peptide Database - Bacteria

 Entry Details
ID   226
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P57322    (Created: 2000-12-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   DEGP_BUCAI
Protein Name   Probable serine protease do-like
Gene   degP
Organism Scientific   Buchnera aphidicola subsp. Acyrthosiphon pisum
Organism Common   Acyrthosiphon pisum symbiotic bacterium
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Buchnera
Protein Length [aa]   478
Protein Mass [Da]   52230
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   26
chain   Probable serine protease do-like      27   478
disulfide bond      by similarity   87   99
domain   PDZ 1      281   372
domain   PDZ 2      387   469
region of interest   Serine protease      116   254
active site   Charge relay system   potential   133   133
active site   Charge relay system   potential   163   163
active site   Charge relay system   potential   238   238
SP Length   26
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKSAIILSKIILILTLLLSFGMSWN
Sequence MKKSAIILSKIILILTLLLSFGMSWNNVFSNTKNSIVSREISPSLAPMLE
KVMPSVISINIEGSAITRTSRLPHQFQPFFGDNSPF
CQGNSPFRHSPFCH
INPDSDDKKEKFRAL
GSGVIINADKGYAVTNNHVVENANKIQVQLSDGRR
YEARVIGKDSRS
DIALIQLKNANNLSEIKIADSDNLRVGDYTVAIGNPYG
LGETVTSGIISALGRSGLNIEHYENFIQTDAAINRGN
SGGALVNLKGELI
GINT
AILAPDGGNIGIGFAIPCNMVKNLTAQMVQFGQVRRGELGIMGMEL
NSDLAQIMKINSQKGAFVSRVLPNSSAFEAGIKAGDIIISLNRKPISSFS
SLRAEIGSLPVATKMELGVFRE
GRIKNITVELKHSVKHNLNSENDYIGIE
GVDLSDYIFNEQKVIKVDNVKPHTPASKIGFKKDDIILNVNQKLISNVDE
LKKFLHSKPKILVFNIKRG
NDTIYLVSE
Original MKKSAIILSKIILILTLLLSFGMSWNNVFSNTKNSIVSREISPSLAPMLE
KVMPSVISINIEGSAITRTSRLPHQFQPFFGDNSPFCQGNSPFRHSPFCH
INPDSDDKKEKFRALGSGVIINADKGYAVTNNHVVENANKIQVQLSDGRR
YEARVIGKDSRSDIALIQLKNANNLSEIKIADSDNLRVGDYTVAIGNPYG
LGETVTSGIISALGRSGLNIEHYENFIQTDAAINRGNSGGALVNLKGELI
GINTAILAPDGGNIGIGFAIPCNMVKNLTAQMVQFGQVRRGELGIMGMEL
NSDLAQIMKINSQKGAFVSRVLPNSSAFEAGIKAGDIIISLNRKPISSFS
SLRAEIGSLPVATKMELGVFREGRIKNITVELKHSVKHNLNSENDYIGIE
GVDLSDYIFNEQKVIKVDNVKPHTPASKIGFKKDDIILNVNQKLISNVDE
LKKFLHSKPKILVFNIKRGNDTIYLVSE
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11