Signal Peptide Database - Bacteria

 Entry Details
ID   229
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q50420    (Created: 1997-11-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   DHMH_METFK
Protein Name   Methylamine dehydrogenase heavy chain
Gene   mauB
Organism Scientific   Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Betaproteobacteria
      Methylophilales
        Methylophilaceae
          Methylobacillus
Protein Length [aa]   400
Protein Mass [Da]   44330
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   27
chain   Methylamine dehydrogenase heavy chain      28   400
SP Length   27
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTTFQPGRLAGQLAATALLAATCSAFA
Sequence MTTFQPGRLAGQLAATALLAATCSAFAADAPTTVPSSLGAIGTTPTLDNI
TMEPGLPSDAKRVYVLDPGHFHVTTTVYTIDGNKNNLLGMTDTGKLANVM
LSSDGKFFVTSNTTYSRIARGKRDDYVEVIDAQSHKVLADIDIPEGRFLT
GVMNRMASLSTDNKYMLFQQFAPSPAVGLVDLEKKSFVKMMDIPDCYQIF
PVPNQSFYMHCRDGSLQQFGYDDKGNLKPMKPTKVFHGEDDYLFVNPYYS
NGSGRLVWPTYEGRIFQAKLTDKKVDFMKPFELFTEAEKKANWRPGGWQV
VAYHKARNEIYVLADQRAKWTHVTASRYVFVVDGTTGKRLRRIDLGHEID
GISVTQDANPNLYAVSAEAKTLFTFNAVTGKETGKVDELGRAPTISLTMD
Original MTTFQPGRLAGQLAATALLAATCSAFAADAPTTVPSSLGAIGTTPTLDNI
TMEPGLPSDAKRVYVLDPGHFHVTTTVYTIDGNKNNLLGMTDTGKLANVM
LSSDGKFFVTSNTTYSRIARGKRDDYVEVIDAQSHKVLADIDIPEGRFLT
GVMNRMASLSTDNKYMLFQQFAPSPAVGLVDLEKKSFVKMMDIPDCYQIF
PVPNQSFYMHCRDGSLQQFGYDDKGNLKPMKPTKVFHGEDDYLFVNPYYS
NGSGRLVWPTYEGRIFQAKLTDKKVDFMKPFELFTEAEKKANWRPGGWQV
VAYHKARNEIYVLADQRAKWTHVTASRYVFVVDGTTGKRLRRIDLGHEID
GISVTQDANPNLYAVSAEAKTLFTFNAVTGKETGKVDELGRAPTISLTMD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11