Signal Peptide Database - Bacteria

 Entry Details
ID   246
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q2SFU6    (Created: 2008-03-18 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   DTMLH_HAHCH
Protein Name   Dictomallein-like protein
Gene   dtmL
Organism Scientific   Hahella chejuensis (strain KCTC 2396)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Oceanospirillales
        Hahellaceae
          Hahella
Protein Length [aa]   645
Protein Mass [Da]   70582
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   13
chain   Dictomallein-like protein      14   645
domain   Peptidase M66      136   447
active site      by similarity   334   334
metal ion-binding site   Zinc; catalytic   by similarity   333   333
metal ion-binding site   Zinc; catalytic   by similarity   337   337
metal ion-binding site   Zinc; catalytic   by similarity   343   343
SP Length   13
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKLSMVMVLLVLA
Sequence MKLSMVMVLLVLAGQLSGCGGNDDNNSERTHESGDSNGDVTTPDNDASSN
DEDDAALEPTQLRSVEFAQSHVLPPGGLSWDLKESGELQLVEKRDTLVLA
TFDEAVQAAEVRVYDKNHQLLSSLNLSKPSDLPPT
EGDDLPYSDDAWSAV
IPSDDMSKGVNIRVVAQGKSASEIVTPALHPELDLTIQSLPFLIYGANES
NIPFKIDDLKVMFADPDTAGQGFAGMPFSKTHIVNHPLGVFESDYLIAPP
SGSAPAKKVESAADPDYSKPILDMVWHIEYATGDMALNKITFAPSMLIDH
SKAGPIKTRGFGGMAYTGSGASMGYPSLGLLW
HEGGHALGLPHSLSGSKD
LRGPYYPYAEGSLSGSAWGYDQHKGYFRSPLTAPTSRYFVCNGERGGGVF
QKTPEGRCYRFDPMHSADEQKDPDAAFPLFSDFNAGKMQRWVRNRAR
MNP
SNDGFQVLDDNGDWADFVPETKHYAGWHIKEHYPVSFDKTTDFIMITYSL
AGTDAASHFYNPIRYKGNAIEYVDAINQDGLNSINADISSGARAKYSDYC
RRQGCDFTLKVTYEDGSTSYRVLKGSARKDWQPSVWKDDYLNENSKDSYL
FWAVALVAPDGAPKVKKLELLDTPILWNLSPTAVMGAEALVVKQL
Original MKLSMVMVLLVLAGQLSGCGGNDDNNSERTHESGDSNGDVTTPDNDASSN
DEDDAALEPTQLRSVEFAQSHVLPPGGLSWDLKESGELQLVEKRDTLVLA
TFDEAVQAAEVRVYDKNHQLLSSLNLSKPSDLPPTEGDDLPYSDDAWSAV
IPSDDMSKGVNIRVVAQGKSASEIVTPALHPELDLTIQSLPFLIYGANES
NIPFKIDDLKVMFADPDTAGQGFAGMPFSKTHIVNHPLGVFESDYLIAPP
SGSAPAKKVESAADPDYSKPILDMVWHIEYATGDMALNKITFAPSMLIDH
SKAGPIKTRGFGGMAYTGSGASMGYPSLGLLWHEGGHALGLPHSLSGSKD
LRGPYYPYAEGSLSGSAWGYDQHKGYFRSPLTAPTSRYFVCNGERGGGVF
QKTPEGRCYRFDPMHSADEQKDPDAAFPLFSDFNAGKMQRWVRNRARMNP
SNDGFQVLDDNGDWADFVPETKHYAGWHIKEHYPVSFDKTTDFIMITYSL
AGTDAASHFYNPIRYKGNAIEYVDAINQDGLNSINADISSGARAKYSDYC
RRQGCDFTLKVTYEDGSTSYRVLKGSARKDWQPSVWKDDYLNENSKDSYL
FWAVALVAPDGAPKVKKLELLDTPILWNLSPTAVMGAEALVVKQL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11