Signal Peptide Database - Bacteria

 Entry Details
ID   253
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q3YZZ8    (Created: 2006-03-07 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   ECOT_SHISS
Protein Name   Ecotin
Gene   eco
Organism Scientific   Shigella sonnei (strain Ss046)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Shigella
Protein Length [aa]   162
Protein Mass [Da]   18180
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   20
chain   Ecotin      21   162
disulfide bond      by similarity   70   107
site   Reactive bond   by similarity   104   105
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKTILPAVLFAAFATTSAWA
Sequence MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQ
EDESTLKVELLTGQTLEVD
CNLHRLGGKLENKTLEGWGYDYYVFDKVSSP
VST
MMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVW
KAEEKIDNAVVR
Original MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQ
EDESTLKVELLTGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSP
VSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVW
KAEEKIDNAVVR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11