Signal Peptide Database - Bacteria

 Entry Details
ID   258
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P13811    (Created: 1990-01-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ELBH_ECOLX
Protein Name   Heat-labile enterotoxin B chain
Gene   eltB
Organism Scientific   Escherichia coli
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Escherichia
Protein Length [aa]   124
Protein Mass [Da]   14027
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   21
chain   Heat-labile enterotoxin B chain      22   124
disulfide bond         30   107
sequence variant   (in strain: Isolate 240-3)      0   0
sequence variant   (in strain: Isolate H10407, Isolate 240-3)      0   0
sequence variant   (in strain: Isolate H10407)      0   0
sequence variant   (in strain: Isolate H10407)      0   0
strand         36   44
strand         46   51
strand         59   62
strand         68   71
strand         102   109
helix         26   30
helix         82   98
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNKVKFYVLFTALLSSLCAHG
Sequence MNKVKFYVLFTALLSSLCAHGAPQSITELCSEYHNTQIYTINDKILSYTE
S
MAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTE
T
KIDKLCVWNNKTPNSIAAISMEN
Original MNKVKFYVLFTALLSSLCAHGAPQSITELCSEYHNTQIYTINDKILSYTE
SMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTE
TKIDKLCVWNNKTPNSIAAISMEN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11