Signal Peptide Database - Bacteria

 Entry Details
ID   261
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q5HHM6    (Created: 2007-01-09 Updated: 2008-07-22)
UniProtKB/Swiss-Prot Entry Name   EMP_STAAC
Protein Name   Extracellular matrix protein-binding protein emp
Gene   emp
Organism Scientific   Staphylococcus aureus (strain COL)
Organism Common  
Lineage   Bacteria
  Firmicutes
    Bacillales
      Staphylococcus
Protein Length [aa]   340
Protein Mass [Da]   38485
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   26
chain   Extracellular matrix protein-binding protein emp      27   340
SP Length   26
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKKLLVLTMSTLFATQIMNSNHAKA
Sequence MKKKLLVLTMSTLFATQIMNSNHAKASVTESVDKKFVVPESGINKIIPAY
DEFKNSPKVNVSNLTDNKNFVASEDKLNKIADSSAASKIVDKNFVVPESK
LGNIVPEYKEINNRVNVATNNPASQQVDKHFVAKGPEVNRFITQNKVNHH
FITTQTHYKKVITSYKSTHVHKHVNHAKDSINKHFIVKPSESPRYTHPSQ
SLIIKHHFAVPGYHAHKFVTPGHASIKINHFCVVPQINSFKVIPPYGHNS
HRMHVPSFQNNTTATHQNAKVNKAYDYKYFYSYKVVKGVKKYFSFSQSNG
YKIGKPSLNIKNVNYQYAVPSYSPTHYVPEFKGSLPAPRV
Original MKKKLLVLTMSTLFATQIMNSNHAKASVTESVDKKFVVPESGINKIIPAY
DEFKNSPKVNVSNLTDNKNFVASEDKLNKIADSSAASKIVDKNFVVPESK
LGNIVPEYKEINNRVNVATNNPASQQVDKHFVAKGPEVNRFITQNKVNHH
FITTQTHYKKVITSYKSTHVHKHVNHAKDSINKHFIVKPSESPRYTHPSQ
SLIIKHHFAVPGYHAHKFVTPGHASIKINHFCVVPQINSFKVIPPYGHNS
HRMHVPSFQNNTTATHQNAKVNKAYDYKYFYSYKVVKGVKKYFSFSQSNG
YKIGKPSLNIKNVNYQYAVPSYSPTHYVPEFKGSLPAPRV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11