Signal Peptide Database - Bacteria

 Entry Details
ID   265
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P34071    (Created: 1994-02-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ENTC2_STAAU
Protein Name   Enterotoxin type C-2
Gene   entC2
Organism Scientific   Staphylococcus aureus
Organism Common  
Lineage   Bacteria
  Firmicutes
    Bacillales
      Staphylococcus
Protein Length [aa]   266
Protein Mass [Da]   30604
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   27
chain   Enterotoxin type C-2      28   266
disulfide bond         120   137
strand         60   65
strand         75   79
strand         83   85
strand         89   94
strand         109   113
strand         135   139
strand         142   144
strand         156   164
strand         167   182
strand         209   216
strand         222   226
strand         231   233
strand         249   251
strand         256   262
helix         41   43
helix         49   52
helix         98   105
helix         183   198
helix         237   241
helix         242   246
metal ion-binding site   Zinc      36   36
metal ion-binding site   Zinc      110   110
metal ion-binding site   Zinc      145   145
metal ion-binding site   Zinc      149   149
turn         35   37
turn         53   55
turn         252   254
SP Length   27
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNKSRFISCVILIFALILVLFTPNVLA
Sequence MNKSRFISCVILIFALILVLFTPNVLAESQPDPTPDELHKSSEFTGTMGN
MK
YLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDL
AKKYK
DEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHF
DNGNL
QNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNL
YEFNSSPY
ETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTV
D
SKSVKIEVHLTTKNG
Original MNKSRFISCVILIFALILVLFTPNVLAESQPDPTPDELHKSSEFTGTMGN
MKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDL
AKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHF
DNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNL
YEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTV
DSKSVKIEVHLTTKNG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11