Signal Peptide Database - Bacteria

 Entry Details
ID   277
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P0A5P5    (Created: 2005-03-15 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   ERP_MYCBO
Protein Name   Exported repetitive protein
Gene   erp
Organism Scientific   Mycobacterium bovis
Organism Common  
Lineage   Bacteria
  Actinobacteria
    Actinobacteridae
      Actinomycetales
        Corynebacterineae
          Mycobacteriaceae
            Mycobacterium
              Mycobacterium tuberculosis complex
Protein Length [aa]   284
Protein Mass [Da]   27700
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   22
chain   Exported repetitive protein      23   284
transmembrane region      potential   253   273
topological domain   Extracellular   potential   23   252
topological domain   Cytoplasmic   potential   274   284
region of interest   6 X 5 AA tandem repeats of P-[GA]-L-T-S      92   121
region of interest   6 X 5 AA approximate tandem repeats of P- [ATG]-[LG]-X-X      144   173
repeat   1-1      92   96
repeat   1-2      97   101
repeat   1-3      102   106
repeat   1-4      107   111
repeat   1-5      112   116
repeat   1-6      117   121
repeat   2-1      144   148
repeat   2-2      149   153
repeat   2-3      154   158
repeat   2-4      159   163
repeat   2-5      164   168
repeat   2-6      169   173
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MPNRRRRKLSTAMSAVAALAVA
Sequence MPNRRRRKLSTAMSAVAALAVASPCAYFLVYESTETTERPEHHEFKQAAV
LTDLPGELMSALSQGLSQFGINIPPVPSLTGSGDASTGLTG
PGLTSPGLT
S
PGLTSPGLTDPALTSPGLTPTLPGSLAAPGTTLAPTPGVGANPALTNPA
LTS
PTGATPGLTSPTGLDPALGGANEIPITTPVGLDPGADGTYPILGDPT
LGTIPSSPATTSTGGGGLVNDVMQVANELGASQAIDLLKGVLMPSIMQAV
QN
GGAAAPAASPPVPPIPAAAAVPPTDPITVPVA
Original MPNRRRRKLSTAMSAVAALAVASPCAYFLVYESTETTERPEHHEFKQAAV
LTDLPGELMSALSQGLSQFGINIPPVPSLTGSGDASTGLTGPGLTSPGLT
SPGLTSPGLTDPALTSPGLTPTLPGSLAAPGTTLAPTPGVGANPALTNPA
LTSPTGATPGLTSPTGLDPALGGANEIPITTPVGLDPGADGTYPILGDPT
LGTIPSSPATTSTGGGGLVNDVMQVANELGASQAIDLLKGVLMPSIMQAV
QNGGAAAPAASPPVPPIPAAAAVPPTDPITVPVA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11