Signal Peptide Database - Bacteria

 Entry Details
ID   30
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q1I563    (Created: 2008-02-05 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ALGL_PSEE4
Protein Name   Alginate lyase
Gene   algL
Organism Scientific   Pseudomonas entomophila (strain L48)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Pseudomonadales
        Pseudomonadaceae
          Pseudomonas
Protein Length [aa]   367
Protein Mass [Da]   40986
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   24
chain   Alginate lyase      25   367
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTIINRKTAPALLALALFGGAAQA
Sequence MTIINRKTAPALLALALFGGAAQAALVPPQGYYEGIEKLKSSDGDFRCEA
APRPYTGSLRFRSKYEGSDKARATLNVASEKAFRASTKDITTLEKGVSKM
VGQYMRDGRPAQLDCALTWLGTWARADALMSSDYNHTGKSMRKWALGSMS
GSWLRLKFSNSQPLAAHQAEAEQIEKWFARLAQQTVRDWSGLPLEKINNH
SYWAAWSVMATAVATDRRDLFDWAVKEYKVGANQVDEQGFLPNELKRRQR
ALAYHNYALPPLAMIASFAQANGVDLRKENNFALQRLGEGVLAGARDPSQ
FTAHAGVKQDLHDLKIDSKYAWLEPWCALYHCVGDTLERKHDMQPFDSFR
LGGDVTRVYDPGAESKK
Original MTIINRKTAPALLALALFGGAAQAALVPPQGYYEGIEKLKSSDGDFRCEA
APRPYTGSLRFRSKYEGSDKARATLNVASEKAFRASTKDITTLEKGVSKM
VGQYMRDGRPAQLDCALTWLGTWARADALMSSDYNHTGKSMRKWALGSMS
GSWLRLKFSNSQPLAAHQAEAEQIEKWFARLAQQTVRDWSGLPLEKINNH
SYWAAWSVMATAVATDRRDLFDWAVKEYKVGANQVDEQGFLPNELKRRQR
ALAYHNYALPPLAMIASFAQANGVDLRKENNFALQRLGEGVLAGARDPSQ
FTAHAGVKQDLHDLKIDSKYAWLEPWCALYHCVGDTLERKHDMQPFDSFR
LGGDVTRVYDPGAESKK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11