Signal Peptide Database - Bacteria

 Entry Details
ID   32
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P37710    (Created: 1994-10-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ALYS_ENTFA
Protein Name   Autolysin
Gene   EF_0799
Organism Scientific   Enterococcus faecalis
Organism Common   Streptococcus faecalis
Lineage   Bacteria
  Firmicutes
    Lactobacillales
      Enterococcaceae
        Enterococcus
Protein Length [aa]   737
Protein Mass [Da]   77025
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   53
chain   Autolysin      54   737
repeat   LysM 1      363   405
repeat   LysM 2      431   473
repeat   LysM 3      499   541
repeat   LysM 4      567   609
repeat   LysM 5      633   675
repeat   LysM 6      695   737
SP Length   53
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKESMSRIERRKAQQRKKTPVQWKKSTTLFSSALIVSSVGTPVALLPVT
AEA
Sequence MKKESMSRIERRKAQQRKKTPVQWKKSTTLFSSALIVSSVGTPVALLPVT
AEA
TEEQPTNAEVAQAPTTETGLVETPTTETTPGTTEQPTTDSSTTTEST
TESSKETPTTPSTEQPTADSTTPVESGTTDSSVAEITPVAPSATESEAAP
AVTPDDEVKVPEARVASAQTFSALSPTQSPSEFIAELARCAQPIAQANDL
YASVMMAQAIVESGWGASTLSKAPNYNLFGIKGSYNGQSVYMDTWEYLNG
KWLVKKEPFRKYPSYMESFQDNAHVLKTTSFQAGVYYYAGAWKSNTSSYR
DATAWLTGRYATDPSYNAKLNNVITAYNLTQYDTPSSGGNTGGGTVNPGT
GGSNNQSGTNTY
YTVKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFVGQ
KLIVK
KGASGNTGGSGSGGSNNNQSGTNTYYTVKSGDTLNKIAAQYGVSV
ANLRSWNGISGDLIFVGQKLIVK
KGASGNTGGSNNGGSNNNQSGTNTYYT
IKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFAGQKIIVK
KGTSGNTGG
SSNGGSNNNQSGTNTY
YTIKSGDTLNKISAQFGVSVANLQAWNNISGSLI
FAGQKIIVK
KGANSGSTNTNKPTNNGGGATTSYTIKSGDTLNKISAQFGV
SVANLRSWNGIKGDLIFAGQTIIVK
KGASAGGNASSTNSASGKRHTVKSG
DSLWGLSMQYGISIQKIKQLNGLSGDTIYIGQTLKVG
Original MKKESMSRIERRKAQQRKKTPVQWKKSTTLFSSALIVSSVGTPVALLPVT
AEATEEQPTNAEVAQAPTTETGLVETPTTETTPGTTEQPTTDSSTTTEST
TESSKETPTTPSTEQPTADSTTPVESGTTDSSVAEITPVAPSATESEAAP
AVTPDDEVKVPEARVASAQTFSALSPTQSPSEFIAELARCAQPIAQANDL
YASVMMAQAIVESGWGASTLSKAPNYNLFGIKGSYNGQSVYMDTWEYLNG
KWLVKKEPFRKYPSYMESFQDNAHVLKTTSFQAGVYYYAGAWKSNTSSYR
DATAWLTGRYATDPSYNAKLNNVITAYNLTQYDTPSSGGNTGGGTVNPGT
GGSNNQSGTNTYYTVKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFVGQ
KLIVKKGASGNTGGSGSGGSNNNQSGTNTYYTVKSGDTLNKIAAQYGVSV
ANLRSWNGISGDLIFVGQKLIVKKGASGNTGGSNNGGSNNNQSGTNTYYT
IKSGDTLNKIAAQYGVSVANLRSWNGISGDLIFAGQKIIVKKGTSGNTGG
SSNGGSNNNQSGTNTYYTIKSGDTLNKISAQFGVSVANLQAWNNISGSLI
FAGQKIIVKKGANSGSTNTNKPTNNGGGATTSYTIKSGDTLNKISAQFGV
SVANLRSWNGIKGDLIFAGQTIIVKKGASAGGNASSTNSASGKRHTVKSG
DSLWGLSMQYGISIQKIKQLNGLSGDTIYIGQTLKVG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11