Signal Peptide Database - Bacteria

 Entry Details
ID   33
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P33772    (Created: 1994-02-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   AMIA_SALTY
Protein Name   Probable N-acetylmuramoyl-L-alanine amidase amiA
Gene   amiA
Organism Scientific   Salmonella typhimurium
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Salmonella
Protein Length [aa]   289
Protein Mass [Da]   31659
Features  
TypeDescriptionStatusStartEnd
signal peptide   Tat-type signal   potential   1   34
chain   Probable N-acetylmuramoyl-L-alanine amidase amiA      35   289
SP Length   34
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MSTFKLLKTLTSRRQVLKTGLAALTLSGMSHAVA
Sequence MSTFKLLKTLTSRRQVLKTGLAALTLSGMSHAVAKEETLKTSNGHSKPKT
KKTGSKRLVMLDPGHGGIDTGAIGRNGSQEKHVVLAIAKNVRAILRNHGI
DARLTRTGDTFIPLYDRVEIAHKHGADLFMSIHADGFTNPKAAGASVFAL
SNRGASSAMAKYLSERENRADEVAGKKATDRDHLLQQVLFDLVQTDTIKN
SLTLGSHILKKIKPIHKLHSRTTEQAAFVVLKSPSIPSVLVETSFITNPE
EERLLGTTAFRQKIATAIANGIISYFHWFDNQKAHTKKR
Original MSTFKLLKTLTSRRQVLKTGLAALTLSGMSHAVAKEETLKTSNGHSKPKT
KKTGSKRLVMLDPGHGGIDTGAIGRNGSQEKHVVLAIAKNVRAILRNHGI
DARLTRTGDTFIPLYDRVEIAHKHGADLFMSIHADGFTNPKAAGASVFAL
SNRGASSAMAKYLSERENRADEVAGKKATDRDHLLQQVLFDLVQTDTIKN
SLTLGSHILKKIKPIHKLHSRTTEQAAFVVLKSPSIPSVLVETSFITNPE
EERLLGTTAFRQKIATAIANGIISYFHWFDNQKAHTKKR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11