Signal Peptide Database - Bacteria

 Entry Details
ID   37
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P25718    (Created: 1992-05-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   AMY1_ECOLI
Protein Name   Alpha-amylase
Gene   malS
Organism Scientific   Escherichia coli (strain K12)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Escherichia
Protein Length [aa]   676
Protein Mass [Da]   75713
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   17
chain   Alpha-amylase      18   676
disulfide bond         57   75
disulfide bond         121   537
active site   Nucleophile   by similarity   460   460
active site   Proton donor   by similarity   503   503
active site      by similarity   565   565
metal ion-binding site   Calcium   by similarity   314   314
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   464   464
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKLAACFLTLLPGFAVA
Sequence MKLAACFLTLLPGFAVAASWTSPGFPAFSEQGTGTFVSHAQLPKGTRPLT
LNFDQQ
CWQPADAIKLNQMLSLQPCSNTPPQWRLFRDGEYTLQIDTRSGT
PTLMISIQNAAEPVASLVRE
CPKWDGLPLTVDVSATFPEGAAVRDYYSQQ
IAIVKNGQIMLQPAATSNGLLLLERAETDTSAPFDWHNATVYFVLTDRFE
NGDPSNDQSYGRHKDGMAEIGTFHGGDLRGLTNKLDYLQQLGVNALWISA
PFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSA
HQRGIRILFDVVM
NHTGYATLADMQEYQFGALYLSGDEVKKSLGERWSDW
KPAAGQTWHSFNDYINFSDKTGWDKWWGKNWIRTDIGDYDNPGFDDLTMS
LAFLPDIKTESTTASGLPVFYKNKMDTHAKAIDGYTPRDYLTHWLSQWVR
DYGIDGFRV
DTAKHVELPAWQQLKTEASAALREWKKANPDKALDDKPFWM
TG
EAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAQMDTTWQQMAE
KLQGFNVLSYLSSH
DTRLFREGGDKAAELLLLAPGAVQIFYGDESSRPFG
PTGSDPLQGTRSDMNWQDVSGKSAASVAHWQKISQFRARHPAIGAGKQTT
LLLKQGYGFVREHGDDKVLVVWAGQQ
Original MKLAACFLTLLPGFAVAASWTSPGFPAFSEQGTGTFVSHAQLPKGTRPLT
LNFDQQCWQPADAIKLNQMLSLQPCSNTPPQWRLFRDGEYTLQIDTRSGT
PTLMISIQNAAEPVASLVRECPKWDGLPLTVDVSATFPEGAAVRDYYSQQ
IAIVKNGQIMLQPAATSNGLLLLERAETDTSAPFDWHNATVYFVLTDRFE
NGDPSNDQSYGRHKDGMAEIGTFHGGDLRGLTNKLDYLQQLGVNALWISA
PFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSA
HQRGIRILFDVVMNHTGYATLADMQEYQFGALYLSGDEVKKSLGERWSDW
KPAAGQTWHSFNDYINFSDKTGWDKWWGKNWIRTDIGDYDNPGFDDLTMS
LAFLPDIKTESTTASGLPVFYKNKMDTHAKAIDGYTPRDYLTHWLSQWVR
DYGIDGFRVDTAKHVELPAWQQLKTEASAALREWKKANPDKALDDKPFWM
TGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAQMDTTWQQMAE
KLQGFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESSRPFG
PTGSDPLQGTRSDMNWQDVSGKSAASVAHWQKISQFRARHPAIGAGKQTT
LLLKQGYGFVREHGDDKVLVVWAGQQ
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11