Signal Peptide Database - Bacteria

 Entry Details
ID   62
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   A4TL44    (Created: 2008-01-15 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ASR_YERPP
Protein Name   Acid shock protein
Gene   asr
Organism Scientific   Yersinia pestis (strain Pestoides F)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Yersinia
Protein Length [aa]   121
Protein Mass [Da]   12580
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   21
chain   Acid shock protein      64   121
propeptide      by similarity   22   63
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKKVLALMVAATLGLSSVAFA
Sequence MKKVLALMVAATLGLSSVAFAADTTATATPAATSTTATVAAQTKATQHQK
HKVTKKTTEQKAQ
AAKKHEKKASVQKTPVQKAQAAKKHVKKASVQKAPVQ
KAQAAKKHHKTAKKPVAAPAA
Original MKKVLALMVAATLGLSSVAFAADTTATATPAATSTTATVAAQTKATQHQK
HKVTKKTTEQKAQAAKKHEKKASVQKTPVQKAQAAKKHVKKASVQKAPVQ
KAQAAKKHHKTAKKPVAAPAA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11