Signal Peptide Database - Bacteria

 Entry Details
ID   67
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P81177    (Created: 1998-07-15 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   AURE_STAAU
Protein Name   Zinc metalloproteinase aureolysin
Gene   aur
Organism Scientific   Staphylococcus aureus
Organism Common  
Lineage   Bacteria
  Firmicutes
    Bacillales
      Staphylococcus
Protein Length [aa]   509
Protein Mass [Da]   56321
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   27
chain   Zinc metalloproteinase aureolysin      210   509
strand         210   216
strand         222   230
strand         233   238
strand         240   243
strand         245   250
strand         257   259
strand         261   267
strand         305   309
strand         323   325
strand         327   332
strand         337   341
strand         391   394
strand         407   411
helix         270   272
helix         273   293
helix         343   345
helix         347   361
helix         369   386
helix         413   416
helix         422   424
helix         430   438
helix         440   453
helix         455   468
helix         476   490
helix         493   504
active site         353   353
active site   Proton donor      436   436
propeptide         28   209
metal ion-binding site   Calcium 1      348   348
metal ion-binding site   Zinc; catalytic      352   352
metal ion-binding site   Zinc; catalytic      356   356
metal ion-binding site   Zinc; catalytic      376   376
metal ion-binding site   Calcium 1      387   387
metal ion-binding site   Calcium 2      387   387
metal ion-binding site   Calcium 2      389   389
metal ion-binding site   Calcium 1      390   390
metal ion-binding site   Calcium 2      390   390
metal ion-binding site   Calcium 1; via carbonyl oxygen      392   392
metal ion-binding site   Calcium 1      395   395
metal ion-binding site   Calcium 2      395   395
metal ion-binding site   Calcium 3; via carbonyl oxygen      398   398
metal ion-binding site   Calcium 3      399   399
metal ion-binding site   Calcium 3; via carbonyl oxygen      402   402
metal ion-binding site   Calcium 3      405   405
turn         252   254
turn         395   397
turn         505   507
SP Length   27
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRKFSRYAFTSMATVTLLSSLTPAALA
Sequence MRKFSRYAFTSMATVTLLSSLTPAALASDTNHKPATSDINFEITQKSDAV
KALKELPKSENVKNHYQDYSVTDVKTDKKGFTHYTLQPSVDGVHAPDKEV
KVHADKSGKVVLINGDTDAKKVKPTNKVTLSKDEAADKAFNAVKIDKNKA
KNLQDDVIKENKVEIDGDSNKYIYNIELITVTPEISHWKVKIDADTGAVV
EKTNLVKEA
AATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNF
NDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDN
HGSP
IVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVV
A
HELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTP
G
KEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVI
QAI
GKSKSEQIYYRALTEYLTSNSNFKDCKDALYQAAKDLYDEQTAEQVY
EAWN
EVGVE
Original MRKFSRYAFTSMATVTLLSSLTPAALASDTNHKPATSDINFEITQKSDAV
KALKELPKSENVKNHYQDYSVTDVKTDKKGFTHYTLQPSVDGVHAPDKEV
KVHADKSGKVVLINGDTDAKKVKPTNKVTLSKDEAADKAFNAVKIDKNKA
KNLQDDVIKENKVEIDGDSNKYIYNIELITVTPEISHWKVKIDADTGAVV
EKTNLVKEAAATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNF
NDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDN
HGSPIVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVV
AHELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTP
GKEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVI
QAIGKSKSEQIYYRALTEYLTSNSNFKDCKDALYQAAKDLYDEQTAEQVY
EAWNEVGVE
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11