Signal Peptide Database - Bacteria

 Entry Details
ID   74
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P48982    (Created: 1996-02-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   BGAL_XANMN
Protein Name   Beta-galactosidase
Gene   bga
Organism Scientific   Xanthomonas manihotis
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Xanthomonadales
        Xanthomonadaceae
          Xanthomonas
Protein Length [aa]   598
Protein Mass [Da]   66086
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   21
chain   Beta-galactosidase      22   598
active site   Proton donor   potential   184   184
active site   Nucleophile   potential   260   260
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLRTTLAPLVLALALALPAAA
Sequence MLRTTLAPLVLALALALPAAAATPESWPTFGTQGTQFVRDGKPYQLLSGA
IHFQRIPRAYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGNNDV
AAFVKEAAAQGLNVILRPGPYACAEWEAGGYPAWLFGKGNIRVRSRDPRF
LAASQAYLDALAKQVQPLLNHNGGPIIAVQVEN
EYGSYADDHAYMADNRA
MYVKAGFDKALLFTSDGADMLANGTLPDTLAVVNFAPGEAKSAFDKLIKF
RPDQPRMVG
EYWAGWFDHWGKPHAATDARQQAEEFEWILRQGHSANLYMF
IGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAILDEAGHPTPKFALMRD
AIARVTGVQPPALPAPITTTTLPATPLRESASLWDNLPTPIAIDTPQPME
QFGQDYGYILYRTTITGPRKGPLYLGDVRDVARVYVDQRPVGSVERRLQQ
VSLEVEIPAGQHTLDVLVENSGRINYGTRMADGRAGLVDPVLLDSQQLTG
WQAFPLPMRTPDSIRGWTGKAVQGPAFHRGTLRIGTPTDTYLDMRAFGKG
FAWANGVNLGRHWNIGPQTALYLRPSSARVTTRWWSSTWTMLHPSVRG
Original MLRTTLAPLVLALALALPAAAATPESWPTFGTQGTQFVRDGKPYQLLSGA
IHFQRIPRAYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGNNDV
AAFVKEAAAQGLNVILRPGPYACAEWEAGGYPAWLFGKGNIRVRSRDPRF
LAASQAYLDALAKQVQPLLNHNGGPIIAVQVENEYGSYADDHAYMADNRA
MYVKAGFDKALLFTSDGADMLANGTLPDTLAVVNFAPGEAKSAFDKLIKF
RPDQPRMVGEYWAGWFDHWGKPHAATDARQQAEEFEWILRQGHSANLYMF
IGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAILDEAGHPTPKFALMRD
AIARVTGVQPPALPAPITTTTLPATPLRESASLWDNLPTPIAIDTPQPME
QFGQDYGYILYRTTITGPRKGPLYLGDVRDVARVYVDQRPVGSVERRLQQ
VSLEVEIPAGQHTLDVLVENSGRINYGTRMADGRAGLVDPVLLDSQQLTG
WQAFPLPMRTPDSIRGWTGKAVQGPAFHRGTLRIGTPTDTYLDMRAFGKG
FAWANGVNLGRHWNIGPQTALYLRPSSARVTTRWWSSTWTMLHPSVRG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11