Signal Peptide Database - Bacteria

 Entry Details
ID   76
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P0AD64    (Created: 2005-12-06 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   BLA1_KLEPN
Protein Name   Beta-lactamase SHV-1
Gene   bla
Organism Scientific   Klebsiella pneumoniae
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Klebsiella
Protein Length [aa]   286
Protein Mass [Da]   31224
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   21
chain   Beta-lactamase SHV-1      22   286
disulfide bond         73   119
region of interest   Substrate binding      230   232
strand         37   46
strand         52   57
strand         192   195
strand         211   213
strand         226   233
strand         239   247
strand         253   261
helix         25   36
helix         65   67
helix         68   81
helix         95   97
helix         105   108
helix         115   125
helix         128   137
helix         140   150
helix         164   166
helix         179   191
helix         197   208
helix         214   220
helix         235   237
helix         266   282
active site   Acyl-ester intermediate      66   66
active site   Proton acceptor      164   164
turn         47   49
turn         109   111
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRYIRLCIISLLATLPLAVHA
Sequence MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASG
R
TLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVD
YSPV
SEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQ
IGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQ
RQLLQWMV
DDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNK
AE
RIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Original MRYIRLCIISLLATLPLAVHASPQPLEQIKLSESQLSGRVGMIEMDLASG
RTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVD
YSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQ
IGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQ
RQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNK
AERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11