Signal Peptide Database - Bacteria

 Entry Details
ID   77
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9KJA9    (Created: 2003-04-23 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   BLAB5_FLAME
Protein Name   Carbapenem-hydrolyzing beta-lactamase blaB-5
Gene   blaB5
Organism Scientific   Flavobacterium meningosepticum
Organism Common   Chryseobacterium meningosepticum
Lineage   Bacteria
  Bacteroidetes
    Flavobacteria
      Flavobacteriales
        Flavobacteriaceae
          Elizabethkingia
Protein Length [aa]   249
Protein Mass [Da]   28161
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   22
chain   Carbapenem-hydrolyzing beta-lactamase blaB-5      23   249
metal ion-binding site   Zinc 1   by similarity   98   98
metal ion-binding site   Zinc 1   by similarity   100   100
metal ion-binding site   Zinc 2   by similarity   102   102
metal ion-binding site   Zinc 1   by similarity   161   161
metal ion-binding site   Zinc 2   by similarity   180   180
metal ion-binding site   Zinc 2   by similarity   222   222
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLKRLKGLLVLALGFTGLQVFG
Sequence MLKRLKGLLVLALGFTGLQVFGQQNPDIKIEKLKDNLYVYTTYNTFKGTK
YAANAVYMVTDKGVVVIDSPWGEDKFKSFTDEIYKKHGKKVIMNIAT
HSH
DDRAGGLEYFGKLGAKTYSTKMTDSILAKENKPRAKYTFDNNKSFKVGNT
EFQVYYPGKG
HTADNVVVWFPKDKVLVGGCIVKSGDSKDLGYIGEAYVND
WTQSIHNIQQKFPDVQYVVAG
HDDWKDQTSIQHTLDLISDYQQKQKASN
Original MLKRLKGLLVLALGFTGLQVFGQQNPDIKIEKLKDNLYVYTTYNTFKGTK
YAANAVYMVTDKGVVVIDSPWGEDKFKSFTDEIYKKHGKKVIMNIATHSH
DDRAGGLEYFGKLGAKTYSTKMTDSILAKENKPRAKYTFDNNKSFKVGNT
EFQVYYPGKGHTADNVVVWFPKDKVLVGGCIVKSGDSKDLGYIGEAYVND
WTQSIHNIQQKFPDVQYVVAGHDDWKDQTSIQHTLDLISDYQQKQKASN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11