Signal Peptide Database - Bacteria

 Entry Details
ID   86
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   A7ML93    (Created: 2008-02-05 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   BTUB_ENTS8
Protein Name   Vitamin B12 transporter btuB
Gene   btuB
Organism Scientific   Enterobacter sakazakii (strain ATCC BAA-894)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Cronobacter
Protein Length [aa]   616
Protein Mass [Da]   68200
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   20
chain   Vitamin B12 transporter btuB      21   616
transmembrane region      potential   158   165
transmembrane region      potential   169   178
transmembrane region      potential   184   195
transmembrane region      potential   217   227
transmembrane region      potential   232   248
transmembrane region      potential   265   279
transmembrane region      potential   281   298
transmembrane region      potential   311   327
transmembrane region      potential   330   339
transmembrane region      potential   355   371
transmembrane region      potential   373   383
transmembrane region      potential   387   402
transmembrane region      potential   405   419
transmembrane region      potential   436   445
transmembrane region      potential   451   460
transmembrane region      potential   475   492
transmembrane region      potential   496   511
transmembrane region      potential   519   531
transmembrane region      potential   537   552
transmembrane region      potential   560   574
transmembrane region      potential   587   598
transmembrane region      potential   604   616
region of interest   Cobalamin-binding   by similarity   108   112
region of interest   Cobalamin-binding   by similarity   249   251
region of interest   Cobalamin-binding   by similarity   517   520
metal ion-binding site   Calcium 1   by similarity   199   199
metal ion-binding site   Calcium 1   by similarity   211   211
metal ion-binding site   Calcium 1   by similarity   213   213
metal ion-binding site   Calcium 2   by similarity   213   213
metal ion-binding site   Calcium 1   by similarity   215   215
metal ion-binding site   Calcium 2   by similarity   215   215
metal ion-binding site   Calcium 2; via carbonyl oxygen   by similarity   249   249
metal ion-binding site   Calcium 2   by similarity   250   250
metal ion-binding site   Calcium 1   by similarity   250   250
metal ion-binding site   Calcium 2   by similarity   263   263
short sequence motif   TonB box      26   33
short sequence motif   TonB C-terminal box      599   616
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MIKKISLLTALSVTAFSGWA
Sequence MIKKISLLTALSVTAFSGWAQDSGSDSLVVTANRFQQPVNTVLAPTSVVT
REDIERWQANTVIDVMRRLPGVDTAQSGGMGQLSSLFIRGTNSSHVLILV
DGIRLNQ
AGVTGSSDLSQFPLALVQRIEYIRGPRSAVYGSDAIGGVVNII
TTRAKDG
TTLNAGIGSHSYQNYGGSTQQTLGDNTRVTLAGDYTYTRGFDV
VAEGNNGGLA
QPDRDGFMNKTLYGALEHAFSDQWTGFVRGYGYSNRTAYD
GYYNSFTPDVLVDTRQLYSQTWDAGLRFNNDLFHSQLLSSYSHSKDYNYD
PHLGRYDSTA
TLDEIKQYNVQWTNAVDVGHGNIGAGVDWQKQSTEPGTSY
VTNG
YDLRNTGVYLTALQKFGDVTLEGAVRSDDNSQFGRHGTWQSSAAWE
FI
EGYRFIASYGTAYKAPNLGQLYGFYGNDHLDPEESKQWEGAFEGLTAG
VNWRVSAYRNDVDNLIDFNNNLQEYYNVGKARIKGVEATASFDTGPLTHT
LGYDYVDARNA
ATNALLVRRAKQQVKYQLDTQLYDFDWSLTYHYLGTRYD
TD
FSTYPTQNVKLGGVSLWDVAVSYPVTSHLTVRGKIANLFDKDYETAYG
YATAGREYTLSGSYTF
Original MIKKISLLTALSVTAFSGWAQDSGSDSLVVTANRFQQPVNTVLAPTSVVT
REDIERWQANTVIDVMRRLPGVDTAQSGGMGQLSSLFIRGTNSSHVLILV
DGIRLNQAGVTGSSDLSQFPLALVQRIEYIRGPRSAVYGSDAIGGVVNII
TTRAKDGTTLNAGIGSHSYQNYGGSTQQTLGDNTRVTLAGDYTYTRGFDV
VAEGNNGGLAQPDRDGFMNKTLYGALEHAFSDQWTGFVRGYGYSNRTAYD
GYYNSFTPDVLVDTRQLYSQTWDAGLRFNNDLFHSQLLSSYSHSKDYNYD
PHLGRYDSTATLDEIKQYNVQWTNAVDVGHGNIGAGVDWQKQSTEPGTSY
VTNGYDLRNTGVYLTALQKFGDVTLEGAVRSDDNSQFGRHGTWQSSAAWE
FIEGYRFIASYGTAYKAPNLGQLYGFYGNDHLDPEESKQWEGAFEGLTAG
VNWRVSAYRNDVDNLIDFNNNLQEYYNVGKARIKGVEATASFDTGPLTHT
LGYDYVDARNAATNALLVRRAKQQVKYQLDTQLYDFDWSLTYHYLGTRYD
TDFSTYPTQNVKLGGVSLWDVAVSYPVTSHLTVRGKIANLFDKDYETAYG
YATAGREYTLSGSYTF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11