Signal Peptide Database - Bacteria

 Entry Details
ID   87
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8X8Z0    (Created: 2002-03-05 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   BTUF_ECO57
Protein Name   Vitamin B12-binding protein
Gene   btuF
Organism Scientific   Escherichia coli O157:H7
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Gammaproteobacteria
      Enterobacteriales
        Enterobacteriaceae
          Escherichia
Protein Length [aa]   266
Protein Mass [Da]   29394
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   22
chain   Vitamin B12-binding protein      23   266
disulfide bond      by similarity   183   259
domain   Fe/B12 periplasmic-binding      25   266
region of interest   Cobalamin-binding   by similarity   242   246
site   Important for btuC binding   by similarity   72   72
site   Important for btuC binding   by similarity   202   202
binding site   Cobalamin   by similarity   50   50
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAKSLFRALVALSFLAPLWLNA
Sequence MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPVGVSSY
SDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASL
GIKVMWVDATNIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQY
ADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVS
R
EQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPR
IILAAQQLCNALSQVD
Original MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPVGVSSY
SDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASL
GIKVMWVDATNIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQY
ADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVS
REQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPR
IILAAQQLCNALSQVD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11