Signal Peptide Database - Bacteria

 Entry Details
ID   91
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8UH04    (Created: 2004-02-16 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   C556_AGRT5
Protein Name   Cytochrome c-556
Gene   Atu0881
Organism Scientific   Agrobacterium tumefaciens (strain C58 / ATCC 33970)
Organism Common  
Lineage   Bacteria
  Proteobacteria
    Alphaproteobacteria
      Rhizobiales
        Rhizobiaceae
          Rhizobium/Agrobacterium group
            Agrobacterium
Protein Length [aa]   146
Protein Mass [Da]   14985
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   24
chain   Cytochrome c-556      25   146
metal ion-binding site   Iron (heme axial ligand)   by similarity   35   35
metal ion-binding site   Iron (heme axial ligand)   by similarity   139   139
binding site   Heme (covalent)   by similarity   135   135
binding site   Heme (covalent)   by similarity   138   138
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MCMKLKTITAAMLFGCLCAGAVYA
Sequence MCMKLKTITAAMLFGCLCAGAVYAAGEVEKREGMMKQIGGSMGALAAISK
GEKPFDAAAVKAAVTTISTNAKAFPDQFPVGSETGSAAAPAIWENFDDFK
AKAAKLGTDADAVLANLPTDQAGVATAMKTLGAD
CGTCHQTYRLKK
Original MCMKLKTITAAMLFGCLCAGAVYAAGEVEKREGMMKQIGGSMGALAAISK
GEKPFDAAAVKAAVTTISTNAKAFPDQFPVGSETGSAAAPAIWENFDDFK
AKAAKLGTDADAVLANLPTDQAGVATAMKTLGADCGTCHQTYRLKK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11