Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1073
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P08144    (Created: 1988-08-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   AMYA_DROME
Protein Name   Alpha-amylase A
Gene   Amy-p
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   494
Protein Mass [Da]   53746
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   18
chain   Alpha-amylase A      19   494
disulfide bond      by similarity   46   102
disulfide bond      by similarity   153   167
disulfide bond      by similarity   376   382
disulfide bond      by similarity   448   460
modified residue   Pyrrolidone carboxylic acid   by similarity   19   19
sequence variant   (in strain: Canton-S)      0   0
sequence variant   (in strain: JP-75, KN-7, KN-15, KN-17, KN-21, KN-23)      0   0
sequence variant   (in strain: 1420#1, KN-3, KN-9, KN-10, KO140, L16, TN256)      0   0
sequence variant   (in strain: Canton-S)      0   0
sequence variant   (in strain: JP-70, KN-17, KN- 21)      0   0
sequence variant   (in strain: 1420#1, KO140, KN-3, KN-9, KN-10, L16)      0   0
sequence variant   (in strain: KN-21)      0   0
sequence variant   (in strain: 1420#1, J87, JP-60, JP-70, JP-75, KO123, KO140, KN-9, KN-15, KN-21, L16, TN256)      0   0
sequence variant   (in strain: Berkeley)      0   0
sequence variant   (in strain: J87, JP-60, KO123)      0   0
sequence variant   (in strain: 1420#1)      0   0
sequence variant   (in strain: KN-23)      0   0
sequence variant   (in strain: KN-3, KN-9, KN-10, L16)      0   0
sequence variant   (in strain: TN256, 1420#1, KO140)      0   0
sequence variant   (in strain: KN-3, KN-9, KN-10, L16)      0   0
sequence variant   (in strain: Berkeley, JP-1, JP-5, JP-15, JP-35, JP-55, JP-65, JP-84, KN-12, KN-22, KN-27)      0   0
sequence variant   (in strain: KN-28)      0   0
sequence variant   (in strain: KN-22, KN-23)      0   0
active site   Nucleophile   by similarity   204   204
active site   Proton donor   by similarity   241   241
active site      by similarity   306   306
metal ion-binding site   Calcium   by similarity   116   116
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   165   165
metal ion-binding site   Calcium   by similarity   174   174
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   208   208
binding site   Chloride   by similarity   202   202
binding site   Chloride   by similarity   304   304
binding site   Chloride   by similarity   343   343
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFLAKSIVCLALLAVANA
Sequence MFLAKSIVCLALLAVANAQFDTNYASGRSGMVHLFEWKWDDIAAECENFL
GPNGYAGVQVSPVNENAVKDSRPWWERYQPISYKLETRSGNEEQFASMVK
RC
NAVGVRTYVDVVFNHMAADGGTYGTGGSTASPSSKSYPGVPYSSLDFN
PT
CAISNYNDANEVRNCELVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAG
F
RVDAAKHMWPADLAVIYGRLKNLNTDHGFASGSKAYIVQEVIDMGGEAI
SKSEYTGLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAWGFAASDRSLV
FVD
NHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSF
TDTDQGPPTTDGHNIASPIFNSDNS
CSGGWVCEHRWRQIYNMVAFRNTVG
SDEIQNWWDNGSNQISFSRGSRGFVAFNNDNYDLNSSLQTGLPAGTY
CDV
ISGSKSGSSC
TGKTVTVGSDGRASINIGSSEDDGVLAIHVNAKL
Original MFLAKSIVCLALLAVANAQFDTNYASGRSGMVHLFEWKWDDIAAECENFL
GPNGYAGVQVSPVNENAVKDSRPWWERYQPISYKLETRSGNEEQFASMVK
RCNAVGVRTYVDVVFNHMAADGGTYGTGGSTASPSSKSYPGVPYSSLDFN
PTCAISNYNDANEVRNCELVGLRDLNQGNSYVQDKVVEFLDHLIDLGVAG
FRVDAAKHMWPADLAVIYGRLKNLNTDHGFASGSKAYIVQEVIDMGGEAI
SKSEYTGLGAITEFRHSDSIGKVFRGKDQLQYLTNWGTAWGFAASDRSLV
FVDNHDNQRGHGAGGADVLTYKVPKQYKMASAFMLAHPFGTPRVMSSFSF
TDTDQGPPTTDGHNIASPIFNSDNSCSGGWVCEHRWRQIYNMVAFRNTVG
SDEIQNWWDNGSNQISFSRGSRGFVAFNNDNYDLNSSLQTGLPAGTYCDV
ISGSKSGSSCTGKTVTVGSDGRASINIGSSEDDGVLAIHVNAKL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11