Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1075
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O77019    (Created: 2001-09-26 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   AMYR_DROBA
Protein Name   Alpha-amylase-related protein
Gene   Amyrel
Organism Scientific   Drosophila bakoue
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   494
Protein Mass [Da]   55666
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   20
chain   Alpha-amylase-related protein      21   494
disulfide bond      by similarity   48   104
disulfide bond      by similarity   157   171
disulfide bond      by similarity   376   382
disulfide bond      potential   418   441
disulfide bond      by similarity   448   460
modified residue   Pyrrolidone carboxylic acid   by similarity   21   21
active site   Nucleophile   by similarity   208   208
active site   Proton donor   by similarity   245   245
active site      by similarity   310   310
metal ion-binding site   Calcium   by similarity   118   118
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   169   169
metal ion-binding site   Calcium   by similarity   178   178
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   212   212
binding site   Chloride   by similarity   206   206
binding site   Chloride   by similarity   308   308
binding site   Chloride   by similarity   343   343
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MIKFALALTLCLAGASLSLA
Sequence MIKFALALTLCLAGASLSLAQHNPRWWGNRNTIVHLFEWKWSDIAEECET
FLAPRGFAGVQVSPVNENIISAGRPWWERYQPISYKLTTRSGNEEEFADM
VRRC
NDVGIRIYVDVLLNHMSGDFDGVAVGTAGTEAEPSKKSFPGVPYTA
QDFHPS
CEITDWNNRFQVQECELVGLKDLNQHSDYVRSKLIEFLDHLIEL
GVAGF
RVDAAKHMAAVDLEYIYGSLSNLNIEHGFPHNARPFIFQEVIDHG
HETVSREEYNELGAVTEFRFSEEIGKAFRGNNALKWLQSWGTDWGFLNSD
QALTFVD
NHDNQRDQGSVLNYKSPRQYKMATAFHLAYPYGISRVMSSFAF
DDHDTPPPQDAQENIISPEFDEDGA
CVNGWICEHRWRQIYAMVGFKNAVR
DTELSGWWDNGDNQISF
CRGNKGFLAVNNNLYDLSQELNTCLPAGEYCDV
ISGSLVDGAC
TGKSVTVNEHGYGYIHIGSDDFDGVLALHVNAKV
Original MIKFALALTLCLAGASLSLAQHNPRWWGNRNTIVHLFEWKWSDIAEECET
FLAPRGFAGVQVSPVNENIISAGRPWWERYQPISYKLTTRSGNEEEFADM
VRRCNDVGIRIYVDVLLNHMSGDFDGVAVGTAGTEAEPSKKSFPGVPYTA
QDFHPSCEITDWNNRFQVQECELVGLKDLNQHSDYVRSKLIEFLDHLIEL
GVAGFRVDAAKHMAAVDLEYIYGSLSNLNIEHGFPHNARPFIFQEVIDHG
HETVSREEYNELGAVTEFRFSEEIGKAFRGNNALKWLQSWGTDWGFLNSD
QALTFVDNHDNQRDQGSVLNYKSPRQYKMATAFHLAYPYGISRVMSSFAF
DDHDTPPPQDAQENIISPEFDEDGACVNGWICEHRWRQIYAMVGFKNAVR
DTELSGWWDNGDNQISFCRGNKGFLAVNNNLYDLSQELNTCLPAGEYCDV
ISGSLVDGACTGKSVTVNEHGYGYIHIGSDDFDGVLALHVNAKV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11