Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1116
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P22815    (Created: 1991-08-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   BOSS_DROME
Protein Name   Protein bride of sevenless
Gene   boss
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   896
Protein Mass [Da]   99950
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   31
chain   Protein bride of sevenless      32   896
transmembrane region      potential   531   554
transmembrane region      potential   570   588
transmembrane region      potential   615   637
transmembrane region      potential   655   676
transmembrane region      potential   693   712
transmembrane region      potential   728   748
transmembrane region      potential   759   781
topological domain   Extracellular   potential   32   530
topological domain   Cytoplasmic   potential   782   896
glycosylation site   N-linked (GlcNAc...)   potential   183   183
glycosylation site   N-linked (GlcNAc...)   potential   307   307
glycosylation site   N-linked (GlcNAc...)   potential   474   474
glycosylation site   N-linked (GlcNAc...)   potential   485   485
SP Length   31
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKVMDALQSGRRKPLPVALLCILVTVFCVLE
Sequence MKVMDALQSGRRKPLPVALLCILVTVFCVLECHGADLTSPTKKSAPLRIT
KPQPTSQQAKPISITTRAPTTVASTTDDEVSSSVDGQLAPLISSTTEGPS
SGTTASLVPEICLNGLQLTVNSADEGTVIRKQEEFVKILEGDVVLSVLTK
DPDSALFVINRVNQANLIMADFEIGIRAISID
NASLAENLLIQEVQFLQQ
CTTYSMGIFVDWELYKQLESVIKDLEYNIWPIPGTRAHLFPKVAHLLHQM
PWGEKIASVEIATETLEMYNEFMEAARQEHMCLMHFKSDDNVYIMFGNKL
ASHFKE
NGTLFSVPTDRTDDEFLADLPNRAFVLMENEIDLSTAVELDATP
TALDEILIGKSVLPSRVLSFAGSIIDLMNWLRGSLSKHCKRGEEHDLYVL
ESCFNFLNFIEDWRTSEYRQAHDTAEILSLLLMRKLGTAMNFQMYQKKVL
TLDKITGESRTELREIASQNFVT
NVTTYYHYNRDNHTSLELKTKFGQVFN
CQYSAGDNRRYPFLFDGESVMFWRIKMDTW
VATGLTAAILGLIATLAILV
FIVV
RISLGDVFEGNPTTSILLLLSLILVFCSFVPYSIEYVGEQRNSHVT
FEDAQTLNTLCAVR
VFIMTLVYCFVFSLLLCRAVMLASIGSEGGFLSHVN
GYIQ
AVICAFSVVAQVGMSVQLLVVMHVASETVSCENIYYGRWLWGLLAY
DFALLCCVGALI
PSIYRSQRNYREGILIVIGSVLIMVIWVAWIALSLFGD
EWRDAAIP
LGLQASGWAVLVGILIPRTFLIVRGIERSDIAQALPSLTSLA
FAQNNQYSSEQSVYECVNPAMRHCSQDEVNHQSPSEIPTLPLRGGGPRRQ
QFFANLRQANANINPQRPPPRPQQSPSRSSVSSLPPSPDHNKITRF
Original MKVMDALQSGRRKPLPVALLCILVTVFCVLECHGADLTSPTKKSAPLRIT
KPQPTSQQAKPISITTRAPTTVASTTDDEVSSSVDGQLAPLISSTTEGPS
SGTTASLVPEICLNGLQLTVNSADEGTVIRKQEEFVKILEGDVVLSVLTK
DPDSALFVINRVNQANLIMADFEIGIRAISIDNASLAENLLIQEVQFLQQ
CTTYSMGIFVDWELYKQLESVIKDLEYNIWPIPGTRAHLFPKVAHLLHQM
PWGEKIASVEIATETLEMYNEFMEAARQEHMCLMHFKSDDNVYIMFGNKL
ASHFKENGTLFSVPTDRTDDEFLADLPNRAFVLMENEIDLSTAVELDATP
TALDEILIGKSVLPSRVLSFAGSIIDLMNWLRGSLSKHCKRGEEHDLYVL
ESCFNFLNFIEDWRTSEYRQAHDTAEILSLLLMRKLGTAMNFQMYQKKVL
TLDKITGESRTELREIASQNFVTNVTTYYHYNRDNHTSLELKTKFGQVFN
CQYSAGDNRRYPFLFDGESVMFWRIKMDTWVATGLTAAILGLIATLAILV
FIVVRISLGDVFEGNPTTSILLLLSLILVFCSFVPYSIEYVGEQRNSHVT
FEDAQTLNTLCAVRVFIMTLVYCFVFSLLLCRAVMLASIGSEGGFLSHVN
GYIQAVICAFSVVAQVGMSVQLLVVMHVASETVSCENIYYGRWLWGLLAY
DFALLCCVGALIPSIYRSQRNYREGILIVIGSVLIMVIWVAWIALSLFGD
EWRDAAIPLGLQASGWAVLVGILIPRTFLIVRGIERSDIAQALPSLTSLA
FAQNNQYSSEQSVYECVNPAMRHCSQDEVNHQSPSEIPTLPLRGGGPRRQ
QFFANLRQANANINPQRPPPRPQQSPSRSSVSSLPPSPDHNKITRF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11