Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   117
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9VL86    (Created: 2006-05-02 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CBPA1_DROME
Protein Name   Zinc carboxypeptidase A 1
Gene   CG17633
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   430
Protein Mass [Da]   47661
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   22
chain   Zinc carboxypeptidase A 1      23   430
disulfide bond      by similarity   252   275
active site   Proton donor   by similarity   363   363
active site   Nucleophile   by similarity   386   386
metal ion-binding site   Zinc   by similarity   187   187
metal ion-binding site   Zinc   by similarity   190   190
metal ion-binding site   Zinc   by similarity   311   311
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MSLNKCLLFALLAIVASASVSA
Sequence MSLNKCLLFALLAIVASASVSAERVRYDNYRMYKVNSENAKQLEVLKDLE
GSSDSIMFLDGVHLVGADIQIIVAPHKVPDFLEILGKSEIKYELQSRDVQ
KSLDEIDEKVAIKGRATTAYNWAQYYELDDTYAWLQSLAQTNPGVVTLIE
GGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGI
HAREWIAPAAATFI
INQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRTPYG
S
CFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGL
KGKVQLYLSL
HAYSQYLLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYG
TTYTGGNIYDAI
YPAAGASVDWAYGTQDVRMAFCYELRPSSTSYLTGFKL
PAEQIVPASEELLDSIVAMATEVKSLGYFD
Original MSLNKCLLFALLAIVASASVSAERVRYDNYRMYKVNSENAKQLEVLKDLE
GSSDSIMFLDGVHLVGADIQIIVAPHKVPDFLEILGKSEIKYELQSRDVQ
KSLDEIDEKVAIKGRATTAYNWAQYYELDDTYAWLQSLAQTNPGVVTLIE
GGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGIHAREWIAPAAATFI
INQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRTPYG
SCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGL
KGKVQLYLSLHAYSQYLLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYG
TTYTGGNIYDAIYPAAGASVDWAYGTQDVRMAFCYELRPSSTSYLTGFKL
PAEQIVPASEELLDSIVAMATEVKSLGYFD
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11