Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1196
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P10040    (Created: 1989-07-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CRB_DROME
Protein Name   Protein crumbs
Gene   crb
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   2146
Protein Mass [Da]   233572
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   88
chain   Protein crumbs      89   2146
disulfide bond      by similarity   269   280
disulfide bond      by similarity   274   289
disulfide bond      by similarity   291   300
disulfide bond      by similarity   308   319
disulfide bond      by similarity   313   329
disulfide bond      by similarity   331   340
disulfide bond      by similarity   350   361
disulfide bond      by similarity   355   372
disulfide bond      by similarity   374   383
disulfide bond      by similarity   390   401
disulfide bond      by similarity   395   410
disulfide bond      by similarity   412   422
disulfide bond      by similarity   429   440
disulfide bond      by similarity   434   449
disulfide bond      by similarity   451   460
disulfide bond      by similarity   466   477
disulfide bond      by similarity   471   486
disulfide bond      by similarity   488   497
disulfide bond      by similarity   503   513
disulfide bond      by similarity   507   518
disulfide bond      by similarity   520   529
disulfide bond      by similarity   547   560
disulfide bond      by similarity   554   567
disulfide bond      by similarity   569   578
disulfide bond      by similarity   584   595
disulfide bond      by similarity   589   600
disulfide bond      by similarity   602   608
disulfide bond      by similarity   611   622
disulfide bond      by similarity   616   632
disulfide bond      by similarity   634   643
disulfide bond      by similarity   650   662
disulfide bond      by similarity   657   671
disulfide bond      by similarity   673   682
disulfide bond      by similarity   689   700
disulfide bond      by similarity   694   709
disulfide bond      by similarity   711   720
disulfide bond      by similarity   727   738
disulfide bond      by similarity   732   747
disulfide bond      by similarity   749   758
disulfide bond      by similarity   765   776
disulfide bond      by similarity   770   785
disulfide bond      by similarity   787   797
disulfide bond      by similarity   804   815
disulfide bond      by similarity   809   824
disulfide bond      by similarity   826   835
disulfide bond      by similarity   842   853
disulfide bond      by similarity   847   888
disulfide bond      by similarity   890   899
disulfide bond      by similarity   906   917
disulfide bond      by similarity   911   926
disulfide bond      by similarity   928   937
disulfide bond      by similarity   944   955
disulfide bond      by similarity   950   964
disulfide bond      by similarity   966   975
disulfide bond      by similarity   982   993
disulfide bond      by similarity   987   1007
disulfide bond      by similarity   1009   1018
disulfide bond      by similarity   1171   1203
disulfide bond      by similarity   1209   1220
disulfide bond      by similarity   1214   1229
disulfide bond      by similarity   1231   1240
disulfide bond      by similarity   1483   1494
disulfide bond      by similarity   1488   1503
disulfide bond      by similarity   1505   1514
disulfide bond      by similarity   1713   1757
disulfide bond      by similarity   1760   1771
disulfide bond      by similarity   1765   1780
disulfide bond      by similarity   1782   1791
disulfide bond      by similarity   1798   1809
disulfide bond      by similarity   1803   1818
disulfide bond      by similarity   1820   1829
disulfide bond      by similarity   1836   1847
disulfide bond      by similarity   1841   1856
disulfide bond      by similarity   1858   1867
disulfide bond      by similarity   1875   1886
disulfide bond      by similarity   1880   1900
disulfide bond      by similarity   1916   1927
disulfide bond      by similarity   1921   1936
disulfide bond      by similarity   1938   1947
disulfide bond      by similarity   1954   1965
disulfide bond      by similarity   1959   1974
disulfide bond      by similarity   1976   1986
disulfide bond      by similarity   1993   2006
disulfide bond      by similarity   2000   2015
disulfide bond      by similarity   2017   2026
disulfide bond      by similarity   2032   2044
disulfide bond      by similarity   2038   2056
disulfide bond      by similarity   2058   2067
transmembrane region      potential   2083   2109
topological domain   Extracellular   potential   89   2082
topological domain   Cytoplasmic   potential   2110   2146
domain   EGF-like 1      265   301
domain   EGF-like 2      304   341
domain   EGF-like 3      346   384
domain   EGF-like 4; calcium-binding   potential   386   423
domain   EGF-like 5      425   461
domain   EGF-like 6      462   498
domain   EGF-like 7      499   530
domain   EGF-like 8      543   579
domain   EGF-like 9      580   609
domain   EGF-like 10      607   644
domain   EGF-like 11; calcium-binding   potential   646   683
domain   EGF-like 12; calcium-binding   potential   685   721
domain   EGF-like 13; calcium-binding   potential   723   759
domain   EGF-like 14; calcium-binding   potential   761   798
domain   EGF-like 15; calcium-binding   potential   800   836
domain   EGF-like 16      838   900
domain   EGF-like 17; calcium-binding   potential   902   938
domain   EGF-like 18; calcium-binding   potential   940   976
domain   EGF-like 19      978   1019
domain   Laminin G-like 1      1021   1203
domain   EGF-like 20      1205   1241
domain   Laminin G-like 2      1248   1478
domain   EGF-like 21      1479   1515
domain   Laminin G-like 3      1555   1755
domain   EGF-like 22      1756   1792
domain   EGF-like 23; calcium-binding   potential   1794   1830
domain   EGF-like 24; calcium-binding   potential   1832   1868
domain   EGF-like 25      1871   1912
domain   EGF-like 26      1912   1948
domain   EGF-like 27; calcium-binding   potential   1950   1987
domain   EGF-like 28; calcium-binding   potential   1989   2027
domain   EGF-like 29      2028   2068
glycosylation site   N-linked (GlcNAc...)   potential   94   94
glycosylation site   N-linked (GlcNAc...)   potential   196   196
glycosylation site   N-linked (GlcNAc...)   potential   236   236
glycosylation site   N-linked (GlcNAc...)   potential   237   237
glycosylation site   N-linked (GlcNAc...)   potential   334   334
glycosylation site   N-linked (GlcNAc...)   potential   398   398
glycosylation site   N-linked (GlcNAc...)   potential   548   548
glycosylation site   N-linked (GlcNAc...)   potential   563   563
glycosylation site   N-linked (GlcNAc...)   potential   734   734
glycosylation site   N-linked (GlcNAc...)   potential   744   744
glycosylation site   N-linked (GlcNAc...)   potential   858   858
glycosylation site   N-linked (GlcNAc...)   potential   882   882
glycosylation site   N-linked (GlcNAc...)   potential   974   974
glycosylation site   N-linked (GlcNAc...)   potential   1006   1006
glycosylation site   N-linked (GlcNAc...)      1100   1100
glycosylation site   N-linked (GlcNAc...)   potential   1112   1112
glycosylation site   N-linked (GlcNAc...)   potential   1136   1136
glycosylation site   N-linked (GlcNAc...)   potential   1190   1190
glycosylation site   N-linked (GlcNAc...)   potential   1243   1243
glycosylation site   N-linked (GlcNAc...)   potential   1253   1253
glycosylation site   N-linked (GlcNAc...)   potential   1352   1352
glycosylation site   N-linked (GlcNAc...)   potential   1361   1361
glycosylation site   N-linked (GlcNAc...)   potential   1439   1439
glycosylation site   N-linked (GlcNAc...)   potential   1452   1452
glycosylation site   N-linked (GlcNAc...)   potential   1543   1543
glycosylation site   N-linked (GlcNAc...)   potential   1737   1737
glycosylation site   N-linked (GlcNAc...)   potential   1749   1749
glycosylation site   N-linked (GlcNAc...)   potential   1806   1806
glycosylation site   N-linked (GlcNAc...)   potential   1846   1846
glycosylation site   N-linked (GlcNAc...)   potential   1882   1882
glycosylation site   N-linked (GlcNAc...)   potential   1891   1891
glycosylation site   N-linked (GlcNAc...)   potential   1897   1897
glycosylation site   N-linked (GlcNAc...)   potential   2027   2027
glycosylation site   N-linked (GlcNAc...)   potential   2033   2033
glycosylation site   N-linked (GlcNAc...)   potential   2066   2066
splice variant   (in isoform B)      0   0
SP Length   88
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAKIANASLSQQQKQRQAETATTTTTTVAASVETATTTARSRDRTKSAAQ
ITSHLLKRAISVYSSPQWIPLFILIYLATDVASVAVPT
Sequence MAKIANASLSQQQKQRQAETATTTTTTVAASVETATTTARSRDRTKSAAQ
ITSHLLKRAISVYSSPQWIPLFILIYLATDVASVAVPT
KEAYFNGSTYLR
LTTPMPIWDHSAISFRSCRGGEILAQQYNKNSIVISVLNDFLQISLAGPA
VHGPNNRLDVKLPYQLLDNRWHTLQFKYEYGNLYLHVDRAASIFA
NSTYN
SQFLTNQDIGYKDAILILGNSFSGCLLDGPGLQFV
NNSTVQNVVFGHCPL
TPGPCSDHDLFTRL
PDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNC
Q
KDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLC
QTNPCLNNGACVVIGGSGALTCECPKGYAGARCE
VDTDECASQPCQNNGS
CIDRINGFSCDCSGTGYTGAFCQ
TNVDECDKNPCLNGGRCFDTYGWYTCQ
CLDGWGGEICD
RPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIA
PSCAQQCPIDSECVGGKCVCKPGSSGYNCQ
TSTGDGASALALTPINCNAT
NGKCLNGGTCSM
NGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQC
LCPENK
VCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDEC
TLHPKICGNGICKNEKGSYKCYCTPGFTGVHCD
SDVDECLSFPCLNGATC
HNKINAYECVCQPGYEGENCE
VDIDECGSNPCSNGSTCIDRINNFTCNCI
PGMTGRICD
IDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELN
IDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCE
QDINECESNPCQYN
GNCLERS
NITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCE
ININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPC
QRGTCYDQIDDYDCDCDANYGGK
NCSVLLKGCDQNPCLNGGACLPYLINE
VTHLY
NCTCENGFQGDKCEKTTTLSMVATSLISVTTEREEGYDINLQFRT
TLPNGVLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGSKL
N
DSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQPSFPRTYLGGT
IPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPDEQDA
NISYTKLENVQ
SGC
PRTEQCKPNPCHSNGECTDLWHTFACHCPRPFFGHTCQHNMTAATFG
HE
NTTHSAVIVETTDVARRAIRSILDISMFIRTREPTGQVFYLGTDPRKA
PTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQKLDNGYNHLIEVV
R
NQTLVQVKLNGTEYFRKTLSTTGLLDAQVLYLGGPAPTRESLLGATTEP
GIIPVPGAGIPIEDTTVPKEADDSRDYFKGIIQDVKVS
NGSLNLIVEMYS
L
NVTDVQVNAKPLGAVTIDRASVLPGEVSDDLCRKNPCLHNAECRNTWND
YTCKCPNGYKGKNCQ
EIEFCQHVTCPGQSLCQNLDDGYECVTNTTFTGQE
RSPL
AFFYFQEQQSDDIVSEASPKQTLKPVIDIAFRTRAGGTLLYIDNVD
GFFEIGVNGGRVTITWKLSALHFGESARFEKENTDGEWSRIYLRAHNSKL
EGGWKGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPESRQARGS
TLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRT
NVSVQQKAQFRLNA
TRPEE
GCILCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLN
TECLN
NGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDL
IASYVCDCPEDYMGPQCD
VLKQMTCENEPCRNGSTCQNGFNASTGNNFTC
TCVPGFEGPLC
DIPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQD
INECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCE
NDIDECNMEGDYC
GGLGRCFNKPGSFQCICQKPYCGAYC
NFTDPCNATDLCSNGGRCVESCGA
KPDYYCECPEGFAGK
NCTAPITAKEDGPSTTDIAIIVIPVVVVLLLIAGA
LLGTFLVMA
RNKRATRGTYSPSAQEYCNPRLEMDNVLKPPPEERLI
Original MAKIANASLSQQQKQRQAETATTTTTTVAASVETATTTARSRDRTKSAAQ
ITSHLLKRAISVYSSPQWIPLFILIYLATDVASVAVPTKEAYFNGSTYLR
LTTPMPIWDHSAISFRSCRGGEILAQQYNKNSIVISVLNDFLQISLAGPA
VHGPNNRLDVKLPYQLLDNRWHTLQFKYEYGNLYLHVDRAASIFANSTYN
SQFLTNQDIGYKDAILILGNSFSGCLLDGPGLQFVNNSTVQNVVFGHCPL
TPGPCSDHDLFTRLPDNFCLNDPCMGHGTCSSSPEGYECRCTARYSGKNC
QKDNGSPCAKNPCENGGSCLENSRGDYQCFCDPNHSGQHCETEVNIHPLC
QTNPCLNNGACVVIGGSGALTCECPKGYAGARCEVDTDECASQPCQNNGS
CIDRINGFSCDCSGTGYTGAFCQTNVDECDKNPCLNGGRCFDTYGWYTCQ
CLDGWGGEICDRPMTCQTQQCLNGGTCLDKPIGFQCLCPPEYTGELCQIA
PSCAQQCPIDSECVGGKCVCKPGSSGYNCQTSTGDGASALALTPINCNAT
NGKCLNGGTCSMNGTHCYCAVGYSGDRCEKAENCSPLNCQEPMVCVQNQC
LCPENKVCNQCATQPCQNGGECVDLPNGDYECKCTRGWTGRTCGNDVDEC
TLHPKICGNGICKNEKGSYKCYCTPGFTGVHCDSDVDECLSFPCLNGATC
HNKINAYECVCQPGYEGENCEVDIDECGSNPCSNGSTCIDRINNFTCNCI
PGMTGRICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELN
IDECLSNPCTNGAKCLDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYN
GNCLERSNITLYQMSRITDLPKVFSQPFSFENASGYECVCVPGIIGKNCE
ININECDSNPCSKHGNCNDGIGTYTCECEPGFEGTHCEINIDECDRYNPC
QRGTCYDQIDDYDCDCDANYGGKNCSVLLKGCDQNPCLNGGACLPYLINE
VTHLYNCTCENGFQGDKCEKTTTLSMVATSLISVTTEREEGYDINLQFRT
TLPNGVLAFGTTGEKNEPVSYILELINGRLNLHSSLLNKWEGVFIGSKLN
DSNWHKVFVAINTSHLVLSANDEQAIFPVGSYETANNSQPSFPRTYLGGT
IPNLKSYLRHLTHQPSAFVGCMQDIMVNGKWIFPDEQDANISYTKLENVQ
SGCPRTEQCKPNPCHSNGECTDLWHTFACHCPRPFFGHTCQHNMTAATFG
HENTTHSAVIVETTDVARRAIRSILDISMFIRTREPTGQVFYLGTDPRKA
PTKNIGDSYVAAKLHGGELLVKMQFSGTPEAYTVGGQKLDNGYNHLIEVV
RNQTLVQVKLNGTEYFRKTLSTTGLLDAQVLYLGGPAPTRESLLGATTEP
GIIPVPGAGIPIEDTTVPKEADDSRDYFKGIIQDVKVSNGSLNLIVEMYS
LNVTDVQVNAKPLGAVTIDRASVLPGEVSDDLCRKNPCLHNAECRNTWND
YTCKCPNGYKGKNCQEIEFCQHVTCPGQSLCQNLDDGYECVTNTTFTGQE
RSPLAFFYFQEQQSDDIVSEASPKQTLKPVIDIAFRTRAGGTLLYIDNVD
GFFEIGVNGGRVTITWKLSALHFGESARFEKENTDGEWSRIYLRAHNSKL
EGGWKGWESMVDPTPAFSTDIDQAAFQSLIATSTQVYLGGMPESRQARGS
TLSAQQGSQFKGCVGEARVGDLLLPYFSMAELYSRTNVSVQQKAQFRLNA
TRPEEGCILCFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLN
TECLNNGTCINQVAAFFCQCQPGFEGQHCEQNIDECADQPCHNGGNCTDL
IASYVCDCPEDYMGPQCDVLKQMTCENEPCRNGSTCQNGFNASTGNNFTC
TCVPGFEGPLCDIPFCEITPCDNGGLCLTTGAVPMCKCSLGYTGRLCEQD
INECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDIDECNMEGDYC
GGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGA
KPDYYCECPEGFAGKNCTAPITAKEDGPSTTDIAIIVIPVVVVLLLIAGA
LLGTFLVMARNKRATRGTYSPSAQEYCNPRLEMDNVLKPPPEERLI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11