Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1223
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P27779    (Created: 1992-08-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   CUP7_DROME
Protein Name   Pupal cuticle protein Edg-78E
Gene   Edg78E
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   122
Protein Mass [Da]   13347
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain   Pupal cuticle protein Edg-78E      17   122
domain   Chitin-binding type R&R      36   96
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MYKYLFCLALIGCACA
Sequence MYKYLFCLALIGCACADNINKDAQIRSFQNDATDAEGNYQYAYETSNGIQ
IQEAGNANGARGAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPP
PVPA
YVLRALEYIRTHPPAPAQKEQQ
Original MYKYLFCLALIGCACADNINKDAQIRSFQNDATDAEGNYQYAYETSNGIQ
IQEAGNANGARGAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPA
YVLRALEYIRTHPPAPAQKEQQ
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11