Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1224
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P16369    (Created: 1990-08-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   CUPP_DROPS
Protein Name   Pupal cuticle protein
Gene   Pcp
Organism Scientific   Drosophila pseudoobscura pseudoobscura
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   192
Protein Mass [Da]   21476
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   15
chain   Pupal cuticle protein      16   192
domain   Chitin-binding type R&R      45   106
SP Length   15
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MHLLMSLFGVLAVMQ
Sequence MHLLMSLFGVLAVMQQQLAVRAAAYIPDSDRNTKTLQNDLQVERDGNYRY
AYETSNGISATQEGLGGVSVQGGSSYTSPEGSVISVSYVADETGYHPVGD
HIPKVP
DYILRALEYIRAHPYQVKDYYTGELKTVAHDAAAFNVYTRNIQD
QTTPRSRPSSTPKTIYLTHPPTLSDAPTRRPLRQRQNDSRRR
Original MHLLMSLFGVLAVMQQQLAVRAAAYIPDSDRNTKTLQNDLQVERDGNYRY
AYETSNGISATQEGLGGVSVQGGSSYTSPEGSVISVSYVADETGYHPVGD
HIPKVPDYILRALEYIRAHPYQVKDYYTGELKTVAHDAAAFNVYTRNIQD
QTTPRSRPSSTPKTIYLTHPPTLSDAPTRRPLRQRQNDSRRR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11