Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1251
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q23933    (Created: 2003-05-16 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   DEC1_DROER
Protein Name   Defective chorion-1 protein
Gene   dec-1
Organism Scientific   Drosophila erecta
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   557
Protein Mass [Da]   61573
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Defective chorion-1 protein      22   557
region of interest   3 X 26 AA tandem repeats of Q-[SG]-P-M- [MT]-M-[EQ]-Q-R-Q-[WS]-[SA]-E-D-Q-A-K- [IM]-Q-Q-[NS]-P-[QM]-[QMV]-[IM]-Q      458   535
repeat   1      458   483
repeat   2      484   509
repeat   3      510   535
non-terminal residue         557   557
non-consecutive residues         389   390
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRLYSHLPLLALLVVQAVGQS
Sequence MRLYSHLPLLALLVVQAVGQSQVTSEDPARDAGSTSNSTAATRPRIPSQE
EILGQMPPIPPIRTGSPQMDVFYMMFPALGSLLRWGSLFPAQSILGAMPD
NLQPEAAASRVVLVLADDATAKARVVRQNPPLNPLGQLMNWPALPQDFQL
PSMDLGPQVGSFLAQLPPMPAIPSILGAAAPVPAPAPAPAATPLAPAPAA
DPPAAPVPDAAQPAILGQAALQNAFTFLNPSNFDASGLLGQSAPTFAPPN
FDFVAQMQRQFFPGMTPAQQPAPAGTDALASDISEVRVRPEAPYSQEAQM
KIKSALEMEQERQQQAQVKDQEQVPLLWFHMPTTQAQVKDQEQVPLLWFH
MPTTQNQDATAEKTLEDLRVEAKLRAFERQVISELRML
QKEAQRRAGNSG
MNSQKANALKRQAKSQEQALSKEDIVQIMAYAYRMANEQMESEKGKQDKV
YAAYRTE
QSPMTMEQRQWSEDQAKIQQNPQQIQQGPMMMQQRQSAEDQAK
MQQSPMMMQ
QSPMMMQQRQSAEDQAKMQQSPMVMQQSPMMMQQSPMMMQQ
RQWTED
P
Original MRLYSHLPLLALLVVQAVGQSQVTSEDPARDAGSTSNSTAATRPRIPSQE
EILGQMPPIPPIRTGSPQMDVFYMMFPALGSLLRWGSLFPAQSILGAMPD
NLQPEAAASRVVLVLADDATAKARVVRQNPPLNPLGQLMNWPALPQDFQL
PSMDLGPQVGSFLAQLPPMPAIPSILGAAAPVPAPAPAPAATPLAPAPAA
DPPAAPVPDAAQPAILGQAALQNAFTFLNPSNFDASGLLGQSAPTFAPPN
FDFVAQMQRQFFPGMTPAQQPAPAGTDALASDISEVRVRPEAPYSQEAQM
KIKSALEMEQERQQQAQVKDQEQVPLLWFHMPTTQAQVKDQEQVPLLWFH
MPTTQNQDATAEKTLEDLRVEAKLRAFERQVISELRMLQKEAQRRAGNSG
MNSQKANALKRQAKSQEQALSKEDIVQIMAYAYRMANEQMESEKGKQDKV
YAAYRTEQSPMTMEQRQWSEDQAKIQQNPQQIQQGPMMMQQRQSAEDQAK
MQQSPMMMQQSPMMMQQRQSAEDQAKMQQSPMVMQQSPMMMQQSPMMMQQ
RQWTEDP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11