Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1260
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9VLK4    (Created: 2000-12-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   DIUX_DROME
Protein Name   Diuretic hormone class 2
Gene   Dh31
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   116
Protein Mass [Da]   12622
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   25
modified residue   Proline amide   potential   106   106
propeptide      potential   26   75
propeptide      potential   112   116
peptide   Diuretic hormone class 2. /FTId=PRO_0000006258      76   106
SP Length   25
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTNRCACFALAFLLFCLLAISSIEA
Sequence MTNRCACFALAFLLFCLLAISSIEAAPMPSQSNGGYGGAGYNELEEVPDD
LLMELMTRFGRTIIRARNDLENSKR
TVDFGLARGYSGTQEAKHRMGLAAA
NFAGGP
GRRRRSETDV
Original MTNRCACFALAFLLFCLLAISSIEAAPMPSQSNGGYGGAGYNELEEVPDD
LLMELMTRFGRTIIRARNDLENSKRTVDFGLARGYSGTQEAKHRMGLAAA
NFAGGPGRRRRSETDV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11