Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   13
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P17644    (Created: 1990-08-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   ACH2_DROME
Protein Name   Acetylcholine receptor subunit alpha-like 2
Gene   nAcRalpha-96Ab
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   576
Protein Mass [Da]   65506
Features  
TypeDescriptionStatusStartEnd
signal peptide      probable   1   21
chain   Acetylcholine receptor subunit alpha-like 2      22   576
disulfide bond      by similarity   169   183
disulfide bond   Associated with receptor activation   by similarity   243   244
transmembrane region      potential   262   285
transmembrane region      potential   293   311
transmembrane region      potential   327   346
transmembrane region      potential   527   545
topological domain   Extracellular   potential   22   261
topological domain   Cytoplasmic   potential   347   526
glycosylation site   N-linked (GlcNAc...)   potential   65   65
glycosylation site   N-linked (GlcNAc...)   potential   254   254
glycosylation site   N-linked (GlcNAc...)   potential   570   570
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAPGCCTTRPRPIALLAHIWR
Sequence MAPGCCTTRPRPIALLAHIWRHCKPLCLLLVLLLLCETVQANPDAKRLYD
DLLSNYNRLIRPVS
NNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHE
WQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAI
LHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLK
HISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPD
IFF
NITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISIL
LSQTMFFLLIS
EIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHY
RKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKINYGLKFSKT
KFGQALMDEMQMNSGGSSPDSLRRMQGRVGAGGCNGMHVTTATNRFSGLV
GALGGGLSTLSGYNGLPSVLSGLDDSLSDVAARKKYPFELEKAIHNVMFI
QHHMQRQDEFNAEDQDWGFVAMVMDR
LFLWLFMIASLVGTFVILGEAPSL
YDDTKAIDVQLSDVAKQIY
NLTEKKN
Original MAPGCCTTRPRPIALLAHIWRHCKPLCLLLVLLLLCETVQANPDAKRLYD
DLLSNYNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHE
WQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAI
LHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLK
HISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPD
IFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISIL
LSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHY
RKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRDLAANKINYGLKFSKT
KFGQALMDEMQMNSGGSSPDSLRRMQGRVGAGGCNGMHVTTATNRFSGLV
GALGGGLSTLSGYNGLPSVLSGLDDSLSDVAARKKYPFELEKAIHNVMFI
QHHMQRQDEFNAEDQDWGFVAMVMDRLFLWLFMIASLVGTFVILGEAPSL
YDDTKAIDVQLSDVAKQIYNLTEKKN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11