Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   136
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P84020    (Created: 2004-07-05 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CECC_DROSE
Protein Name   Cecropin-C
Gene   CecC
Organism Scientific   Drosophila sechellia
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   63
Protein Mass [Da]   6813
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   23
chain   Cecropin-C      24   62
modified residue   Arginine amide   by similarity   62   62
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNFYKIFVFVALILAISIGQSEA
Sequence MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGI
AQQAANVAATA
RG
Original MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGI
AQQAANVAATARG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11