Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1467
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P83869    (Created: 2004-04-26 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   IM14_DROME
Protein Name   Immune-induced peptide 14
Gene   IM14
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   46
Protein Mass [Da]   4995
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   22
peptide   Immune-induced peptide 14. /FTId=PRO_0000021505      23   46
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNCLKICGFFFALIAALATAEA
Sequence MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN
Original MNCLKICGFFFALIAALATAEAGTQVIHAGGHTLIQTDRSQYIRKN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11