Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1470
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9W4Z4    (Created: 2005-03-29 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   INSL6_DROME
Protein Name   Probable insulin-like peptide 6
Gene   Ilp6
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   107
Protein Mass [Da]   11694
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   33
chain   Probable insulin-like peptide 6      34   107
disulfide bond   Interchain (between B and A chains)   by similarity   48   91
disulfide bond   Interchain (between B and A chains)   by similarity   60   105
disulfide bond      by similarity   90   96
propeptide   Connecting peptide   potential   67   76
peptide   Probable insulin-like peptide 6 B chain (Potential). /FTId=PRO_0000016206      34   66
peptide   Probable insulin-like peptide 6 A chain (Potential). /FTId=PRO_0000016208      82   107
SP Length   33
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAA
Sequence MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCST
GLSDVIQKICVSGTVA
LGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRE
LLQYCKG
Original MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCST
GLSDVIQKICVSGTVALGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRE
LLQYCKG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11