Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1512
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q7JZV0    (Created: 2006-11-28 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   LCP2A_DROME
Protein Name   Larval cuticle protein 2A
Gene   Lcp2a
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   117
Protein Mass [Da]   12680
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   16
chain   Larval cuticle protein 2A      17   117
domain   Chitin-binding type R&R      31   97
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKFFIAFACLLAVALA
Sequence MKFFIAFACLLAVALANEDANVLRAEQQVNVDGFAYAVELDNSVNVQQKG
DLNGEEWVVKGSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPP
PIP
EAIQRSLEYIAAHPPSQ
Original MKFFIAFACLLAVALANEDANVLRAEQQVNVDGFAYAVELDNSVNVQQKG
DLNGEEWVVKGSQSWTSPENVPVSIQYIADANGYQVVSANPPLPTPPPIP
EAIQRSLEYIAAHPPSQ
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11