Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1554
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P83972    (Created: 2004-06-07 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   LYSD_DROME
Protein Name   Lysozyme D
Gene   LysD
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   140
Protein Mass [Da]   15636
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   18
chain   Lysozyme D      19   140
disulfide bond      by similarity   24   139
disulfide bond      by similarity   45   129
disulfide bond      by similarity   80   96
disulfide bond      by similarity   92   110
active site      by similarity   50   50
active site      by similarity   68   68
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKAFIVLVALACAAPAFG
Sequence MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRC
AQKVLSQQGWSAWSTWHYCSGWLPSIDDCF
Original MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDDCF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11