Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1597
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P83119    (Created: 2001-11-02 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   MTH12_DROME
Protein Name   Probable G-protein coupled receptor Mth-like 12
Gene   mthl12
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   488
Protein Mass [Da]   56781
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain   Probable G-protein coupled receptor Mth- like 12      18   488
disulfide bond      by similarity   27   81
disulfide bond      by similarity   83   88
disulfide bond      by similarity   92   189
disulfide bond      by similarity   93   104
disulfide bond      by similarity   155   209
transmembrane region   1   potential   216   236
transmembrane region   2   potential   248   268
transmembrane region   3   potential   284   304
transmembrane region   4   potential   316   336
transmembrane region   5   potential   374   394
transmembrane region   6   potential   417   437
transmembrane region   7   potential   455   475
topological domain   Extracellular   potential   18   215
topological domain   Cytoplasmic   potential   237   247
topological domain   Extracellular   potential   269   283
topological domain   Cytoplasmic   potential   305   315
topological domain   Extracellular   potential   337   373
topological domain   Cytoplasmic   potential   395   416
topological domain   Extracellular   potential   438   454
topological domain   Cytoplasmic   potential   476   488
glycosylation site   N-linked (GlcNAc...)   potential   19   19
glycosylation site   N-linked (GlcNAc...)   potential   34   34
glycosylation site   N-linked (GlcNAc...)   potential   55   55
glycosylation site   N-linked (GlcNAc...)   potential   141   141
glycosylation site   N-linked (GlcNAc...)   potential   365   365
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFLWLKCFCTLIIVTIA
Sequence MFLWLKCFCTLIIVTIAKNSSAKIPHCKYDETINISHFKRLNDAYIYEHF
EIPA
NLTGEFDYKELMDGSKVPTEFPNLRGCICKVRPCIRICCARKNILS
NGECSDGVKNEIKLTMLDLTMQDILLTDPTLAELNMIPQY
NSTELLILRE
QFQPCDEIVSLKRDEYTILKDGSILLHTSAEILSNDQYCLYPEIYSDFPE
TIRIINRRCYRNVMP
GIAQLSVISVVGFILTLAVYLSVEKLRNLLGKCLI
CSLFSMFMEYFIWTMDYF
RLLQSICSAAGYMKYFFSMSSYLWFSVVSFHL
WELF
TSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWENDPGKSEW
LPLVGYFGCSVKDW
NSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKVKKG
VKSFAQHDERNTTCLE
FNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHL
LLDT
IVLNLTVYLNAAFGILIFVLLILKGSTFKMIMER
Original MFLWLKCFCTLIIVTIAKNSSAKIPHCKYDETINISHFKRLNDAYIYEHF
EIPANLTGEFDYKELMDGSKVPTEFPNLRGCICKVRPCIRICCARKNILS
NGECSDGVKNEIKLTMLDLTMQDILLTDPTLAELNMIPQYNSTELLILRE
QFQPCDEIVSLKRDEYTILKDGSILLHTSAEILSNDQYCLYPEIYSDFPE
TIRIINRRCYRNVMPGIAQLSVISVVGFILTLAVYLSVEKLRNLLGKCLI
CSLFSMFMEYFIWTMDYFRLLQSICSAAGYMKYFFSMSSYLWFSVVSFHL
WELFTSLNRHEPQYRFLIYNTFVWCTAAIPTVVIFSMNQMWENDPGKSEW
LPLVGYFGCSVKDWNSSSWFYSHIPIVILNSFNVIMFVLTAIYIWKVKKG
VKSFAQHDERNTTCLEFNVQTYIQFVRLFLIMGASWLLDQLTRLAEDSHL
LLDTIVLNLTVYLNAAFGILIFVLLILKGSTFKMIMER
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11