Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1598
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q24395    (Created: 1997-11-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   MTK_DROME
Protein Name   Metchnikowin
Gene   Mtk
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   52
Protein Mass [Da]   5654
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   24
sequence variant   (in strain: 2CPA51)      0   0
sequence variant   (in strain: 2CPA51)      0   0
propeptide         25   26
peptide   Metchnikowin. /FTId=PRO_0000004984      27   52
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MQLNLGAIFLALLGVMATATSVLA
Sequence MQLNLGAIFLALLGVMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGP
IY
Original MQLNLGAIFLALLGVMATATSVLAEPHRHQGPIFDTRPSPFNPNQPRPGP
IY
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11