Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   169
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9NIP6    (Created: 2003-01-17 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   CP2B_DROME
Protein Name   Cardio acceleratory peptide 2b
Gene   capa
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   151
Protein Mass [Da]   16507
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
modified residue   Valine amide      42   42
modified residue   Valine amide      92   92
modified residue   Leucine amide      130   130
propeptide         22   28
propeptide         45   80
propeptide         95   113
propeptide         134   151
peptide   CAP-1. /FTId=PRO_0000029902      31   42
peptide   CAP-2. /FTId=PRO_0000029904      83   92
peptide   CAP-3. /FTId=PRO_0000029906      116   130
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKSMLVHIVLVIFIIAEFSTA
Sequence MKSMLVHIVLVIFIIAEFSTAETDHDKNRRGANMGLYAFPRVGRSDPSLA
NSLRDGLEAGVLDGIYGDASQEDYNEADFQ
KKASGLVAFPRVGRGDAELR
KWAHLLALQQVLD
KRTGPSASSGLWFGPRLGKRSVDAKSFADISKGQKEL
N
Original MKSMLVHIVLVIFIIAEFSTAETDHDKNRRGANMGLYAFPRVGRSDPSLA
NSLRDGLEAGVLDGIYGDASQEDYNEADFQKKASGLVAFPRVGRGDAELR
KWAHLLALQQVLDKRTGPSASSGLWFGPRLGKRSVDAKSFADISKGQKEL
N
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11