Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1772
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q29AU6    (Created: 2008-07-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   RUMI_DROPS
Protein Name   O-glucosyltransferase rumi
Gene   rumi
Organism Scientific   Drosophila pseudoobscura pseudoobscura
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   409
Protein Mass [Da]   47314
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   20
chain   O-glucosyltransferase rumi      21   409
short sequence motif   Prevents secretion from ER      406   409
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLINVVLIILLVGLNGKASG
Sequence MLINVVLIILLVGLNGKASGQNQGLCSPDENASCADSSDTQDEFSFNILR
KIKKALASYQPCSSDANDANCSCHAAVIKSDLAPYKATGVSRQMIESSAR
YGTRYKIYEKRLYREENCMFPARCQGIEHFLLPLVATLPDMDLVINTRDY
PQINMAWGNGAQGPILSFSKTKDHRDIMYPAWTFWAGGPATKLHPRGIGR
WDLMREKLEKRAAAIPWSQKRELGFFRGSRTSDERDSLILLSRRNPELVE
AQYTKNQGWKSPKDTLDAPPAGEVSFEDHCKYKYLFNFRGVAASFRLKHL
FLCQSLVFHVGDEWQEFFYDQLKPWVHYVPLKNYPSQQEYEELLTFFRKN
DALAQEIAQRGRDFIWQHLRMKDIKCYWRRLLKSYVKLLTYEVQPEDQLI
HIQPA
KDEL
Original MLINVVLIILLVGLNGKASGQNQGLCSPDENASCADSSDTQDEFSFNILR
KIKKALASYQPCSSDANDANCSCHAAVIKSDLAPYKATGVSRQMIESSAR
YGTRYKIYEKRLYREENCMFPARCQGIEHFLLPLVATLPDMDLVINTRDY
PQINMAWGNGAQGPILSFSKTKDHRDIMYPAWTFWAGGPATKLHPRGIGR
WDLMREKLEKRAAAIPWSQKRELGFFRGSRTSDERDSLILLSRRNPELVE
AQYTKNQGWKSPKDTLDAPPAGEVSFEDHCKYKYLFNFRGVAASFRLKHL
FLCQSLVFHVGDEWQEFFYDQLKPWVHYVPLKNYPSQQEYEELLTFFRKN
DALAQEIAQRGRDFIWQHLRMKDIKCYWRRLLKSYVKLLTYEVQPEDQLI
HIQPAKDEL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11