Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1800
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P02841    (Created: 1986-07-21 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   SGS7_DROME
Protein Name   Salivary glue protein Sgs-7
Gene   Sgs7
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   74
Protein Mass [Da]   7920
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   23
chain   Salivary glue protein Sgs-7      24   74
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKLIAVTIIACILLIGFSDLALG
Sequence MKLIAVTIIACILLIGFSDLALGGACECQPCGPGGKACTGCPEKPQLCQQ
LISDIRNLQQKIRKCVCGEPQWMI
Original MKLIAVTIIACILLIGFSDLALGGACECQPCGPGGKACTGCPEKPQLCQQ
LISDIRNLQQKIRKCVCGEPQWMI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11