Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1891
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P54626    (Created: 1996-10-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   TRYDG_DROER
Protein Name   Trypsin delta/gamma
Gene   deltaTry
Organism Scientific   Drosophila erecta
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   253
Protein Mass [Da]   25965
Features  
TypeDescriptionStatusStartEnd
signal peptide      probable   1   22
chain   Trypsin delta/gamma      31   253
disulfide bond      by similarity   56   72
disulfide bond      by similarity   180   197
disulfide bond      by similarity   206   230
domain   Peptidase S1      31   253
site   Required for specificity   by similarity   204   204
active site   Charge relay system   by similarity   71   71
active site   Charge relay system   by similarity   116   116
active site   Charge relay system   by similarity   210   210
propeptide   Activation peptide      23   30
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLKFVILLSAVACALGGTIPEG
Sequence MLKFVILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQR
SGSHSCGGSIYTDRVIVTAA
HCLQSVSTSSLQIRAGSSYWNSGGVTVKVS
SFKNHEGYSARTMVN
DIAVIRLSSSLSFSSTIKSISLASSNPPNGAAASV
SGWGTQSSGSNSIPSQLQYVNVNIVSQSRCASSTYGYGSDIRDTMICAAA
SGK
DACQGDSGGPLVSGGVLVGVVSWGQGCAYSNYPGVYASVADLRAWVV
RNA
Original MLKFVILLSAVACALGGTIPEGLLPQLDGRIVGGTATTISSFPWQISLQR
SGSHSCGGSIYTDRVIVTAAHCLQSVSTSSLQIRAGSSYWNSGGVTVKVS
SFKNHEGYSARTMVNDIAVIRLSSSLSFSSTIKSISLASSNPPNGAAASV
SGWGTQSSGSNSIPSQLQYVNVNIVSQSRCASSTYGYGSDIRDTMICAAA
SGKDACQGDSGGPLVSGGVLVGVVSWGQGCAYSNYPGVYASVADLRAWVV
RNA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11