Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1939
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O44342    (Created: 2005-06-07 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   WBL_DROME
Protein Name   Protein windbeutel
Gene   wbl
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   257
Protein Mass [Da]   29444
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Protein windbeutel      22   257
region of interest   CXXC motif      24   27
strand         28   30
strand         42   50
strand         74   82
strand         86   88
strand         107   120
helix         35   39
helix         57   72
helix         92   97
helix         102   104
helix         129   139
helix         151   154
helix         160   162
helix         165   181
helix         185   204
helix         207   220
helix         226   240
short sequence motif   Prevents secretion from ER   probable   254   257
mutagenesis site   Affects subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip; when associated with Q-212      0   0
mutagenesis site   In T6; induces dorsalized embryos      0   0
mutagenesis site   Abolishes homodimerization and subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip; when associated with S-219      0   0
mutagenesis site   Affects subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip but not homodimerization      0   0
mutagenesis site   Affects subcellular targeting of pip but not homodimerization      0   0
mutagenesis site   Does not affect homodimerization. Abolishes homodimerization and subcellular targeting of pip; when associated with N-31      0   0
mutagenesis site   Impairs homodimerization. Abolishes homodimerization and subcellular targeting of pip; when associated with S- 41      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip but not homodimerization      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip      0   0
mutagenesis site   Does not affect subcellular targeting of pip      0   0
mutagenesis site   Affects subcellular targeting of pip      0   0
turn         32   34
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MMHILVTLLLVAIHSIPTTWA
Sequence MMHILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFD
IAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKV
D
DKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCI
KEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRK
IHEV
GYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKT
APE
KEEL
Original MMHILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFD
IAYPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKV
DDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIGRDGCI
KEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQQNARAYLIYMRK
IHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKT
APEKEEL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11