Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   1947
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9VFX1    (Created: 2004-02-16 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   WNT8_DROME
Protein Name   Wnt inhibitor of Dorsal protein
Gene   wntD
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   309
Protein Mass [Da]   34777
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain   Wnt inhibitor of Dorsal protein      17   309
lipid moiety-binding region   S-palmitoyl cysteine      51   51
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MIFAITFFMGITSTLA
Sequence MIFAITFFMGITSTLAAVLEPMSYYQYTQFQAPLSWEDITGKGLKQALDS
CQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTK
DCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRVV
GALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDA
IQLEGASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSK
DGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCV
QLERQYSCY
Original MIFAITFFMGITSTLAAVLEPMSYYQYTQFQAPLSWEDITGKGLKQALDS
CQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTK
DCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSGAIGHNRRVV
GALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDA
IQLEGASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSK
DGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCV
QLERQYSCY
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11