Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   2010
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P62407    (Created: 2004-07-05 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   YELL_DROSI
Protein Name   Protein yellow
Gene   y
Organism Scientific   Drosophila simulans
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   541
Protein Mass [Da]   60603
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Protein yellow      22   541
glycosylation site   N-linked (GlcNAc...)   potential   144   144
glycosylation site   N-linked (GlcNAc...)   potential   215   215
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFQDKGWILVTLITLVTPSWA
Sequence MFQDKGWILVTLITLVTPSWAAYKLQERYSWNQLDFAFPNTRLKDQALAS
GDYIPQNALPVGVEHFGNRLFVTVPRWRDGIPATLTYINMDRSLTGSPEL
IPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLDTGTVGIG
NTTTNPC
PYAVNVFDLTTDTRIRRYELPGVDTNPNTFIANIAVDIGKNCDDAYAYFA
DELGYGLIAYSWEL
NKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIF
GMSLSPIRSDGYRTLYFSPLASHRQFAVSTRILRDETRTEDSYHDFVALD
ERGPNSHTTSRVMSDDGIELFNLIDQNAVGCWHSSMPYSPQFHGIVDRDD
VGLVFPADVKIDENKNVWVLSDRMPVFLLSDLDYSDTNFRIYTAPLATLI
ENTVCDLRNNAYGPPNTVSIPKQAVLPMGPPLYTKQYRPLLPQKPQTSWA
SSPPPPSRTYLPANSGNVVSSISVSTNSVGPAGVEVPKAYIFNQHNGINY
ETSGPHLFPTHQPAQPGVQDGGLKTYVNARQSGWWHHQHQG
Original MFQDKGWILVTLITLVTPSWAAYKLQERYSWNQLDFAFPNTRLKDQALAS
GDYIPQNALPVGVEHFGNRLFVTVPRWRDGIPATLTYINMDRSLTGSPEL
IPYPDWRSNTAGDCANSITTAYRIKVDECGRLWVLDTGTVGIGNTTTNPC
PYAVNVFDLTTDTRIRRYELPGVDTNPNTFIANIAVDIGKNCDDAYAYFA
DELGYGLIAYSWELNKSWRFSAHSYFFPDPLRGDFNVAGINFQWGEEGIF
GMSLSPIRSDGYRTLYFSPLASHRQFAVSTRILRDETRTEDSYHDFVALD
ERGPNSHTTSRVMSDDGIELFNLIDQNAVGCWHSSMPYSPQFHGIVDRDD
VGLVFPADVKIDENKNVWVLSDRMPVFLLSDLDYSDTNFRIYTAPLATLI
ENTVCDLRNNAYGPPNTVSIPKQAVLPMGPPLYTKQYRPLLPQKPQTSWA
SSPPPPSRTYLPANSGNVVSSISVSTNSVGPAGVEVPKAYIFNQHNGINY
ETSGPHLFPTHQPAQPGVQDGGLKTYVNARQSGWWHHQHQG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11